Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2w1 Olfactory Receptor

Gene Symbol Or2w1
Organism Rat
Family 2
Subfamily w
Pseudo No
Location chr17:45,687,100-45,688,100 (-)
Aliases Olr1662

Sequence information


Conceptual translation

MDPSNYSTLHVFILLGFSDHPHLEMILSGVVTFFYIVTLVGNTAIILASLLDPHLHTPMY
FFLRNLSFLDLCFTTSIVPQMLVNLWGPEKTISSVGCIVQLYVYMWLGSIECLLLAVMSY
DRFTAICKPLHYFVIMNPRLCVKMIVMVWGISLANSVVLCTLTVNLPRCGHNLLDHFLCE
LPAMVRIACVDTTTVEMSVFALGIVIVLTPLILILISYGYIAKTVLNMKSKVGQQKAMNT
CGSHLTVVSIFYGTIIYMYLQPGNRASKDQGKFLTLFYTIITPSLNPLIYTLRNRDMKDA
LKKIMRFYHRFS