Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2w1c Olfactory Receptor

Gene Symbol Or2w1c
Organism Rat
Family 2
Subfamily w
Pseudo No
Location chr17:45726196-45727146 (-)
Aliases LOC100912958, LOC100912958

Sequence information


Nucleotide sequence

ATGGACCCAAGCAACTATAGTACTTTGCATGTTTTTATCCTGCTTGGCTTCTCTGACCAC
CCTCACCTGGAAATGATCCTCTCTGGAGTTGTCACCTTCTTTTACATTGTTACACTGGTG
GGTAACACTGCTATCATTCTTGCATCCCTCCTGGATCCCCATCTCCACACACCAATGTAC
TTTTTCCTCAGGAATTTATCTTTCCTGGATCTATGTTTCACAACAAGCATTGTCCCTCAG
ATGCTGGTTAACTTGTGGGGACCTGAAAAGACCATCAGCTCTGTGGGCTGTATTGTTCAG
CTCTACGTGTATATGTGGCTGGGCTCCATTGAGTGTCTGCTCTTGGCTGTCATGTCCTAT
GATCGCTTCACAGCTATTTGTAAGCCCCTGCATTACTTTGTAATCATGAATCCACGTCTG
TGTGTCAAGATGATAGTCATGGTCTGGGGTATTAGTTTGGCCAACTCTGTAGTATTATGC
ACACTCACTGTGAATTTGCCTCGATGTGGACACAACCTCCTGGACCATTTCCTGTGTGAG
CTGCCAGCCATGGTCAGGATAGCTTGTGTAGACACCACAACAGTTGAAATGTCTGTCTTT
GCTCTAGGCATTGTCATTGTCCTTACACCTCTCATCCTTATTCTTATTTCCTATGGCTAC
ATAGCCAAAACTGTGCTCAACATGAAGTCAAAGGCAGGGCAACAAAAAGCAATGAATACC
TGTGGATCTCATCTCACTGTGGTCTCCATATTCTATGGAAGTATTATCTACCTGTACCTA
CAACCTGGTAACAGGGCCTCTAAGGACCAGGGCAAATTCCTCACCCTCTTTTACACAATT
ATCACTCCAAGTCTCAACCCCCTCATTTACACCCTAAGAAACCGAGGCATGAAAGATGCA
CTGAAAAAACTCATGAGATTTTACCACAGATTTTCAGAATTACGCAGAAAC


Conceptual translation

MDPSNYSTLHVFILLGFSDHPHLEMILSGVVTFFYIVTLVGNTAIILASLLDPHLHTPMY
FFLRNLSFLDLCFTTSIVPQMLVNLWGPEKTISSVGCIVQLYVYMWLGSIECLLLAVMSY
DRFTAICKPLHYFVIMNPRLCVKMIVMVWGISLANSVVLCTLTVNLPRCGHNLLDHFLCE
LPAMVRIACVDTTTVEMSVFALGIVIVLTPLILILISYGYIAKTVLNMKSKAGQQKAMNT
CGSHLTVVSIFYGSIIYLYLQPGNRASKDQGKFLTLFYTIITPSLNPLIYTLRNRGMKDA
LKKLMRFYHRFSELRRN