Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or3a4 Olfactory Receptor

Gene Symbol Or3a4
Organism Rat
Family 3
Subfamily a
Pseudo No
Location chr10:60941419-60942351 (-)
Aliases Olr1509, Olr1509

Sequence information


Nucleotide sequence

ATGGATCTGGGAACCTTGGGAAATGATTCCTGTGTGACCACATTTGTCCTGCTGGGTCTC
ACGGAGACTCCATCTTTGCAGCCCATTCTCTTTGTCCTTTTCCTTCTTGCTTATGTAGCT
ACTCTTGGTGGAAATTTCAGCATCTTGGCTGCTATCATTATAGAACCCAAACTCCACACT
CCCATGTATTTCTTCTTGGGGAACTTGTCTATGCTGGATGTTGGATGCATTAGTGTCACC
GTTCCTGCCATGTTGAAACATTTACTATCCAATGACAGACACATTCCCTATGGGGCCTGC
CTCACACAGCTCTTCTTCTTTCACCTCCTGGCTGGGGCAGACTGCTTCCTTCTGACTGTC
ATGGCCTATGACCGTTATCTGGCCATCTGCCACCCCCTCACCTACAACACCCATATGAGT
TGGAATATCCAGAAGGCCTCAGTGTGCCTGTCATGTGTGTTTTCTTTTAGCAATGCACTG
ACCCAAACTGTTGCCTTGTCTACTCTTAAATTCTGTGGCCCCAACACAATCAACCACTTC
TACTGCGACCTCCCTCAGCTATTCCAGCTCTCCTGTTCCAGCATCCAACTCAATGAGCAG
CTGCTCTTTGTAGCAGCAGCTTTCATGGGCGTGGTCCCCTTGGTCCTCATCACTGTGTCA
TATGGCCATGTGGCAGCTGCAGTTCTTCGTATCCGGTCTGCTGAGGGCAGGAAGAAAGCC
TTCTCCACATGCAGCTCTCACCTCACTGTGGTAGGCATCTTCTATGGGACAGGGGTCTTC
AGTTACATGCGGCTGGGGTCAGTGGAATCCTCAGACAAGGACAAAGGCATTGGCATCCTC
AACACTGTCATCAGTCCCATGCTGAACCCACTTATCTACAGTCTTAGAAACCCTGATGTG
CAGGGTGCCCTACGGAAGGTGCTCACAGGGAGG


Conceptual translation

MDLGTLGNDSCVTTFVLLGLTETPSLQPILFVLFLLAYVATLGGNFSILAAIIIEPKLHT
PMYFFLGNLSMLDVGCISVTVPAMLKHLLSNDRHIPYGACLTQLFFFHLLAGADCFLLTV
MAYDRYLAICHPLTYNTHMSWNIQKASVCLSCVFSFSNALTQTVALSTLKFCGPNTINHF
YCDLPQLFQLSCSSIQLNEQLLFVAAAFMGVVPLVLITVSYGHVAAAVLRIRSAEGRKKA
FSTCSSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGIGILNTVISPMLNPLIYSLRNPDV
QGALRKVLTGR