Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c12b-ps Olfactory Receptor

Gene Symbol Or4c12b-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:78,696,800-78,697,900 (+)
Aliases Olr719-ps

Sequence information


Conceptual translation

MENKRNVTEFILIGLTQNPQMQKVVFVSFLVLYLITISGNLLIVVTVINSQALSSPMYFF
LSHLSLIDTIYTSSSAPKLIVDSLQENKVISFNGCMAQVYAEHIFGATEIILLTVMAYDR
YVAICKPLHYTTIMNHKLCIILVGVAWTGGFLHASIQILFTVWLPFCGPNIIDHFMCDLY
PLLELVCMDTHTLGLFVAANSGFICLFNFLLLMGSYVIILHSLKNYSLEGRRKALSTCVS
HITVVVLSFIPCIFVYLRPVTTLPIDKGV/VFYTMVAPLLNPLIYTLRNSEVKNAIRKL
WRK