Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4d10 Olfactory Receptor

Gene Symbol Or4d10
Organism Rat
Family 4
Subfamily d
Pseudo No
Location chr1:228,504,000-228,505,000 (-)
Aliases Olr322

Sequence information


Nucleotide sequence

ATGGAAAACTACACCAGGGTCAAAGAACTTATTTTCCTTGGCCTGACCCAAAGTCACGAA
GTGAGCATGGTGCTGTTTCTCTTCCTTCTCCTGGTGTACGTGACAACTCTGCTGGGGAAC
CTGCTCATCATGGTCACAGTGACCTACGAGTCTCGCCTTCACACCCCCATGTATTTCCTG
CTCAGGAATTTGTCTATTGCTGACATCTGCTTTTCCTCCATCACTGCCCCCAAGGTTCTG
GTGGACCTTCTCTCAGACAGAAAGACCATCTCTTTCAACGGCTGCCTCACTCAGATGTTC
TTCTTCCACCTTATTGGGGGAGTGGATGTGTTTTCTCTCTCTGTGATGGCTCTAGATCGG
TACGTGGCCATCTCCAAGCCCCTGCACTATGTGACCATCATGAGCAGAGGCCGCTGCATT
GGGTTAATAGCGGCCTCCTGGGTGGGGGGCTTTGCCCACTCCATAGTGCAGATTTCTCTC
TTGCTGACACTTCCGTTCTGTGGACCCAATGTTCTTGACACTTTCTACTGTGATGTCCCC
CAGGTCATCAAACTTGCCTGCACAGACATCTTTGTGCTCGAGCTGCTGATGATTTCCAAT
AATGGGATGCTCACTACGCTGTGGTTTTTCTTGCTCCTGATATCTTACATGGTCATATTA
TTATTGCTTAGGTCTCATTCAGGAGAGGGCAGGAAAAAAGCCATCTCCACCTGCACCTCT
CACATCACTGTAATCACCCTGCATTTTGTGCCCTGCATCTATGTCTATGCCAGACCATTC
ACTGCTCTCCCCACAGATAAAGCCATCTCTGTCACCTTCACAGTTATTTCCCCTCTGCTC
AACCCCTTGATCTACACTCTGAGGAACCAGGAAATGAAGTCAGCCATGAGGAGACTCAGG
AAAAGACTTGGACCTTCTCATAGGATAGAGAAG


Conceptual translation

MENYTRVKELIFLGLTQSHEVSMVLFLFLLLVYVTTLLGNLLIMVTVTYESRLHTPMYFL
LRNLSIADICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDVFSLSVMALDR
YVAISKPLHYVTIMSRGRCIGLIAASWVGGFAHSIVQISLLLTLPFCGPNVLDTFYCDVP
QVIKLACTDIFVLELLMISNNGMLTTLWFFLLLISYMVILLLLRSHSGEGRKKAISTCTS
HITVITLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMRRLR
KRLGPSHRIEK