Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f7 Olfactory Receptor

Gene Symbol Or4f7
Organism Rat
Family 4
Subfamily f
Pseudo No
Location chr3:103089455-103090390 (-)
Aliases Olr777, Olr777

Sequence information


Nucleotide sequence

ATGGATAGGAAGAATCACACAGTCGTGTCTGAATTTGTGTTTCTTGGACTCACCCACTCA
TGGGAGATTCAACTCTTCCTTCTTGTGGTCTCTTCTGTGCTCTACATATTAAGCATGAGT
GGAAACATCCTCATTGTATTTTCTGTGACCATTGACCCTCACTTACATTCTCCTATGTAC
TTCCTACTAGCAGGTCTCTCCTTCATTGATTTGGCAGCATGTTCTGTCACTTCCCCCAAG
ATGGTGTATGACTTGTTTAGAAAGCACAAAGTCATCTCCTTTGGAGGCTGTATCACTCAG
ATCTTCTTCATTCATTTAGTTGGTGGAGTGGAGATGGTGCTACTTGTGGCCATGGCATTT
GACAGATATGTGGCCATTTGTAAGCCTCTGCACTACCTTACCATCATGAGCCCAAGAGTG
TGTACTTTGTTTCTGGCTGCTGCTTGGGGCCTAGGCACTAGCCACTCACTGTTCCAGCTG
GCTTTCCTTATTGACTTACCCTTCTGTGGTCCAAATGTCCTGGACAGCTTTTACTGTGAC
CTTCCTAGACTTCTCAGATTGGTCTGTAAAGACACCTACAAGTTGCAGTTCATGGTCACC
ATCAACAGTGGGTTCATCTGTGTTGGCTCTTTCTTGTTGCTTCTCATCTCCTACATCTTC
ATCCTGTTCAGTGTCTGGAAACATTCATCAGGTGGTTCATCCAAAGCCCTTTCTACTCTC
TCAGCTCACATCACAGTGGTGTTTCTTTTCTTTGGTCCCCCTCTGTTTGTATATACATGG
CCCCATCCTCATTCCCAGATAGACAAATTTCTTGCTCTTTTTGACGCAGTTCTTACTCCT
TTTCTGAACCCAGTCATCTATACATTCAGAAATAAAGAGATGAAGGTAGCAATAAAGAGA
GTTTTCAAAGCATTATTAACTTTTAGAAACATTTCA


Conceptual translation

MDRKNHTVVSEFVFLGLTHSWEIQLFLLVVSSVLYILSMSGNILIVFSVTIDPHLHSPMY
FLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGVEMVLLVAMAF
DRYVAICKPLHYLTIMSPRVCTLFLAAAWGLGTSHSLFQLAFLIDLPFCGPNVLDSFYCD
LPRLLRLVCKDTYKLQFMVTINSGFICVGSFLLLLISYIFILFSVWKHSSGGSSKALSTL
SAHITVVFLFFGPPLFVYTWPHPHSQIDKFLALFDAVLTPFLNPVIYTFRNKEMKVAIKR
VFKALLTFRNIS