Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k2 Olfactory Receptor

Gene Symbol Or4k2
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr15:27000876-27001829 (-)
Aliases Olr1608, Olr1608

Sequence information


Nucleotide sequence

ATGATGACTGTGGCTAATAAGTCTATTGTGACTGAATTTGTCTTGCTGGGACTCTCTAAT
TCCTGGGAACTACAGATATTTTTCTTCATAGTGTTTTCAGTCTTTTATGTGGCAACAATG
GTGAGTAATAGCATCATTGTGGTCATTGTCATATCTGACTCTCACCTACACTCTGCTATG
TACTTCCTGCTTACCAACCTTTCTCTCATCGATATGTCTCTTGCTTCCTTTGCCACTCCC
AAGATGATCATAGATTATCTAACTGATCATAAGACCATCTCTTTTGATGGATGCATTGCC
CAGATATTCTTTCTCCACCTGTTCACTGGGACTGAGATTATTTTACTCATGGCCATGTCT
TTTGACAGGTATATTGCAATTTGTAAACCTCTGCGTTACGCTTCGATCATTAGTCCCCAG
GTGTGTATTGCCTTGGTGGTGTCCTCATGGATTGTGGGGATCATGCATTCAATGAGCCAG
GTCATCTTTGCCCTCACATTACCCTTCTGTGGTCCCAATAAGATAGATAGCTTTTTCTGT
GACCTTCCTGTGGTGTTCCAGCTGTCTTGTGTGGATACTTATGTTCTTGGTCTCTTTATG
ATTTCGACAAGTGGCATCATTGCACTGTCTTGCTTCATTCTGCTATTTAATTCCTATGTT
ATTGTGCTGCTTACTATCAAGCACCATTCTTCCAAAGGATCATCTAAGGCTCTTTCAACC
TGCACAGCCCATTTCATTGTTGTCTTCATGTTCTTTGGGCCATGTATCTTTATCTACATG
TGGCCACAAAACAGCTTTGTGATAGAAAAGATCCTGTCCGTATTTTACACCATATTCACT
CCCATTCTGAACCCAGTCATATATACTCTGAGAAACCACGAAGTAAATTCAGCCATGAGG
AAACTGGGAAGTAAGTTTCTAAATTTCAGTACAGAAACTCCTTCCCATTCTTTT


Conceptual translation

MMTVANKSIVTEFVLLGLSNSWELQIFFFIVFSVFYVATMVSNSIIVVIVISDSHLHSAM
YFLLTNLSLIDMSLASFATPKMIIDYLTDHKTISFDGCIAQIFFLHLFTGTEIILLMAMS
FDRYIAICKPLRYASIISPQVCIALVVSSWIVGIMHSMSQVIFALTLPFCGPNKIDSFFC
DLPVVFQLSCVDTYVLGLFMISTSGIIALSCFILLFNSYVIVLLTIKHHSSKGSSKALST
CTAHFIVVFMFFGPCIFIYMWPQNSFVIEKILSVFYTIFTPILNPVIYTLRNHEVNSAMR
KLGSKFLNFSTETPSHSF