Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4m1 Olfactory Receptor

Gene Symbol Or4m1
Organism Rat
Family 4
Subfamily m
Pseudo No
Location chr15:27139719-27140657 (-)
Aliases Olr1612, Olr1612

Sequence information


Nucleotide sequence

ATGGAGCCTGCAAATGATACCACTGTGACCGAATTTGTTCTCACTGGTCTATCTCAGACT
CGGGAAGTACAGCTAGTCTTGTTTGTTATATTTTTATCCTTTTATTTATTCATACTTCCA
GTGAATATCCTTATTATCTGCACCATCAGGCTTGATCCCCATTTGAGTTCTCCCATGTAT
TTCCTGCTGGCTAATTTAGCCTTTCTTGATATTTGGTACTCCTCTATCACAGCACCTAAG
ATGCTTGTAGACTTTTTTGTGGAAAGGAAGATAATTTCCTTTGGTGGGTGCATTGCTCAA
CTCTTCTTCTTGCACTTTGTTGGGGCATCTGAGATGTTCCTGCTGACAGTGATGGCTTTT
GACCGCTATGCTGCCATCTGCCGCCCTCTCCATTATGCTACCATCATGAACCGCCATCTC
TGTTGTATCTTAGTGGCCCTCTCCTGGACAGGGGGCTTCGTTCATTCTATAATACAGGTG
GCTCTCATTGTTCGACTCCCATTTTGTGGGCCCAATGAATTAGACAATTATTTTTGTGAC
ATAACTCAGGTTGTCCGTATTGCCTGTGCCAATACTTTTCTGGAGGAATTGGTCATGATC
TTTAGCAGTGGCCTGATCTCTGTGGTGTGCTTCATTGCTCTGCTAATGTCCTATGCCTTT
CTTCTGGCCATGCTCAAGAAACACTCAAGCTCAGGTGAGAGCACCAGCAGGGCTATATCC
ACTTGTTATTCCCACATCACCATTGTGGTGCTAATGTTTGGACCATCCATCTACATTTAT
GCTCGCCCATTTGACTCGTTTTCTCTAGATAAAGTGGTATCTGTGTTTCATACTGTGATA
TTCCCTTTGCTCAACCCTATCATCTATACATTGAGAAACAAGGAAGTAAAGGCAGCCATG
AAAAAGCTGGTGAATAGATATGTTTTTTGTAAAGAAAAG


Conceptual translation

MEPANDTTVTEFVLTGLSQTREVQLVLFVIFLSFYLFILPVNILIICTIRLDPHLSSPMY
FLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGASEMFLLTVMAF
DRYAAICRPLHYATIMNRHLCCILVALSWTGGFVHSIIQVALIVRLPFCGPNELDNYFCD
ITQVVRIACANTFLEELVMIFSSGLISVVCFIALLMSYAFLLAMLKKHSSSGESTSRAIS
TCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKAAM
KKLVNRYVFCKEK