Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4n4 Olfactory Receptor

Gene Symbol Or4n4
Organism Rat
Family 4
Subfamily n
Pseudo No
Location chr15:27,076,200-27,077,200 (-)
Aliases Olr1611

Sequence information


Nucleotide sequence

ATGGAGACAGAAAACAGGACAGTTGTCACAGAATTCATCCTCATAGGACTGACCCAGTCA
CATGACATTCAGCGCTTGGTCTTTGTTCTGAGCTTAATTTTCTACATCATCATCTTGCCT
GGAAATGTCTTCATCATCCTCACCATCATATCAGACCCTGGACTCACTGCTCCTCTTTAT
CTCTTCCTGGGAAATTTGGCCTTCCTGGATGCCTCCTACTCCTTCATTGTGGCTCCCAGG
ATGCTGGTAGACATCTTCTCTGAGAAGAAGATAATCTCCTACAAAGCTTGTATCACTCAA
CTATTTTTTTTGCACTTCCTCGGAGGAGGGGAATTTTTACTACTGGTTGTGATGGCCTTT
GACCGCTACATCGCCATCTGCAGGCCTTTACATTACTCCACTGTCATGAGTTCCAGAACC
TGCTATGTGATGTTGTTGGCTCCATGGCTTGGAGGTTTGGTTCACTCCATCATTCAGGTT
GTCTTCATCCTCCACTTGCCCTTCTGTGGGCCGAATCATCTAGATAACTTCTTCTGTGAT
GTCCCACAGGTCATCAAGCTAGCCTGTACAGACACCTTTGCAGTTGAGCTCCTAATGATC
TTCAATAGTGGCCTGCTTACCCTCGTGTGCTTCCTTGGTCTTCTGACTTCCTATGCAGTT
ATTTTATGCCATGTCCATAGGTCAGCTTCTGAGGGAAAAAACAAAGCTATATCTACGTGT
ACCACTCATGTTATCATTATATTTCTTATGTTTGGACCTGCAATTTTTATTTATACACGT
CCATTCACAGCCTTATCAGCTGACAAAGTGGTTTCTTTCTTTCAAACAGTAATATTTCCC
TTGATGAATCCTGTGATTTATACTCTTCGAAACCAGGAAGTAAAAACTTCCATGAAAAAG
TTAATTATCCGGCATATTATTTGT


Conceptual translation

METENRTVVTEFILIGLTQSHDIQRLVFVLSLIFYIIILPGNVFIILTIISDPGLTAPLY
LFLGNLAFLDASYSFIVAPRMLVDIFSEKKIISYKACITQLFFLHFLGGGEFLLLVVMAF
DRYIAICRPLHYSTVMSSRTCYVMLLAPWLGGLVHSIIQVVFILHLPFCGPNHLDNFFCD
VPQVIKLACTDTFAVELLMIFNSGLLTLVCFLGLLTSYAVILCHVHRSASEGKNKAISTC
TTHVIIIFLMFGPAIFIYTRPFTALSADKVVSFFQTVIFPLMNPVIYTLRNQEVKTSMKK
LIIRHIIC