Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4n5 Olfactory Receptor

Gene Symbol Or4n5
Organism Rat
Family 4
Subfamily n
Pseudo No
Location chr15:26780042-26780965 (-)
Aliases Olr1624, Olr1624

Sequence information


Nucleotide sequence

ATGGAGATCAAGAACAGCTCAGTAGTCACGGAATTCATCCTCCTTGGCCTGACCCAGTCT
CAAGAGGCTCAACTCCTGGTCTTCACAATGATTTCAGTTTTCTACCTAATAATTCTTCCT
GGAAATTTTCTTATCATTTTCACCATTAGATCAGACCCTGGACTCACAGCCCCACTTTAC
TTCTTTCTGGGAAACTTGGCGTTCCTGGATGCCTCCTACTCCTTCATTGTGGCTCCCAGG
ATGCTGGTGGATTTTTTCTGTGAGAAAAAAGTCATTTCTTACAAAGCCTGCATCACTCAG
TTATTCTTTCTGCACTTTCTTGGAGCGGGAGAAATGTTTCTTCTTGTCGTGATGGCCGTC
GATCGTTATATCGCTATATGTCGTCCTTTATACTACTCTACTCTCATGAACCCTAGAGTC
TGTTATGCATTGTTGCTGGCTCTGTGGCTTGGGGGCTTTGCTCATTCCATTGTACAAGTG
GCCCTTATCCTCAACTTGCCCTTTTGTGGGCCAAACCAGCTGGATAACTTTTTCTGTGAT
GTTCCACAGGTTGTGAAGCTAGCCTGCACGGATACCTTCGCCGTGGAGCTCCTGATGGTT
TCTAACAGTGGTCTACTTACCCTCTTATGCTTCTTGGGACTGCTGGCCTCCTATGCTGTC
ATTCTCTACCACGTAAAAGGACATTCCTCCGAAGGGAAGAGCAAAGCCATCTCTACGTGC
ACCACCCACATTATAATCGTGTTTCTCATGTTTGGGCCTGCCATTTTTATCTATACACGC
CCTTTCCAGGCTCTCCAAGCTGACAAAGTTGTTTCTCTCTTCCACACGGTCATCTTTCCT
TTGATGAATCCTGTGATCTATACACTTCGCAACCAGGAAGTGAAAACTTCTATGAGGAAA
TTGTTAAGTCAGCATGCGGTTTGC


Conceptual translation

MEIKNSSVVTEFILLGLTQSQEAQLLVFTMISVFYLIILPGNFLIIFTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFFCEKKVISYKACITQLFFLHFLGAGEMFLLVVMAV
DRYIAICRPLYYSTLMNPRVCYALLLALWLGGFAHSIVQVALILNLPFCGPNQLDNFFCD
VPQVVKLACTDTFAVELLMVSNSGLLTLLCFLGLLASYAVILYHVKGHSSEGKSKAISTC
TTHIIIVFLMFGPAIFIYTRPFQALQADKVVSLFHTVIFPLMNPVIYTLRNQEVKTSMRK
LLSQHAVC