Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4q3-ps Olfactory Receptor

Gene Symbol Or4q3-ps
Organism Rat
Family 4
Subfamily q
Pseudo Yes
Location chr15:27163525-27164621 (-)
Aliases Olr1878, Olr1878

Sequence information


Nucleotide sequence

CAGTTTAATGTTATTGAATTTCTGCTGCGCCGTGTACATGCAGACGAGCAAGAGGTACTT
CCTCATAAATTTTCCCGTGTTGTCTAACTTAACCCACTTAGTCCAATTGAATCTTTTCTT
ACATTAGGTCACTTGATACTCTTGGCTTGGACAAAAACAAAAATGGCTCCGGGGTGTCGC
AGTTTGTGCTTCTGGGCCTGTCATCTTCCTGGGAGCTCCAGTTATTTCTCTTCTCGACAT
TCTTGTTGGTGTACGTGGTTATTGTCCTGGGAAACCTTTTGATAGTGCTGGTCGTCCAGA
CTGATGCTCGCCTGCTCCAGTCACCCATGTACTATTTTCTACACCATCTGTCTTTCATCG
ACCTCTGTTTGAGCTGTGTCGCTGTGCCCAAAATGCTAGGAGATTTCCTACGGAGGGAGA
AGGTAATACCTTTTTCAGGATGCCTGGCCCAGCTATTCTTCCTTCACTTCCTGGGAGCCT
GTGAAATGTTCCTGCTGACTGTTATGGCCTATGACAGGTATGTTGCCATCTGCAACCCTT
TGCACTACCTCAGAGTCATGAATAGCCACCTGCGTCTTCGGTTGGTGTTTGGCTGCTGGT
GTGGAGGTTTCATTCACTCCATCACGCAGGTCGTGATTGTCATCCGGCTGCCTTTCTGTG
GCCCCAATGAACTGGACAACTTCTACTGTGATGTCCCACAGGTCGTCAAGCTGGCCTGCA
TGGACACTTACTTGGTTGAGGTGCTGATGGTCTCTAACAGTGGCATATTGTCTCTCGCCT
GCTTCTTGGTCCTGCTCTTGTCCTATGCGCTCATTTTGATCACTCTGAGAACTCACCTCC
ACCGGGGCCAGAGCAAAGCACTGTCCACCTGTGCCTCTCACCTCACGGTGGTCAGCCTGA
TCTTCGTACCCTGTGTGTTCATTTACTTGCGGCCTTTCTGCACCTTCTCTGTGGATAAAG
TAGTCTCTGTGTTCTACACAGTGATCACGCCGATGCTGAACCCCCTCATATATACGCTCA
GAAATGCAGACATGAAGAGAGCTATAGGAAAGCTGAGAAAGAAGCAGGTAGCATCCCACT
GCTTTGGTAAAAGATGA


Conceptual translation

KNKNGSGVSQFVLLGLSSSWELQLFLFSTFLLVYVVIVLGNLLIVLVVQTDARLLQSPMY
YFLHHLSFIDLCLSCVAVPKMLGDFLRREKVIPFSGCLAQLFFLHFLGACEMFLLTVMAY
DRYVAICNPLHYLRVMNSHLRLRLVFGCWCGGFIHSITQVVIVIRLPFCGPNELDNFYCD
VPQVVKLACMDTYLVEVLMVSNSGILSLACFLVLLLSYALILITLRTHLHRGQSKALSTC
ASHLTVVSLIFVPCVFIYLRPFCTFSVDKVVSVFYTVITPMLNPLIYTLRNADMKRAIGK
LRKKQVASHCF