Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4x6 Olfactory Receptor

Gene Symbol Or4x6
Organism Rat
Family 4
Subfamily x
Pseudo No
Location chr3:79,017,600-79,018,500 (-)
Aliases Olr736

Sequence information


Nucleotide sequence

ATGGCTCACCTACTCAATGTGACTGAGTTCATTTTCCTGGGACTCTCTCCCAATAAAGAG
GGGCAGAGAGTTTGCTTTGTGCTATTTCTGCTCCTGTACATGGCCATTGTGCTTGGGAAT
CTTCTTATGGTGGTCACTGTGGCAGCCAGCAGAAATCTTGGATCCCCAATGTACTTCTTC
CTCAGCTTCCTCTCCTTTGTGGAGATCTGCTACTCCTCCACAACAGCCCCCAAACTCATC
TTTGATCTCCTTGCTGAAAAGAAATCCATATCTGTGTGGGGCTGCATGACACAGCTTTTC
TTCATGCACTTCTTTGGTGGCACTGAGATTTTCCTGCTCACCATGATGGCCTATGACCGC
TATGTGGCAATCTGCAAGCCCCTGCACTACACCAGCATCATGAACCAACAGGTGTGTGCT
GTCCTTGTAGGATCAGCTTGGATAGGAGGCTTTGTGCATTCCTTTTCCCAGATCCTTCTT
ATTCTTCCTTTATCTTTCTGTGGCCCCAATGTCATTGACCATTATTTCTGTGACTTGCTT
CCTGTGCTTAAACTTGCCTGTTCAGACACCTTCCTCATTGGTCTGCTGATTGTTGTCAAT
GGAGGGACACTGTCTGTGATCAGCTTTGTGGTCCTCTTAGCATCCTATCTGGTCATCTTG
TTCCACCTGAGAACTCAGAGTGCTGAGGGACGGCGCAAAGCTCTGTCCACCTGTGGGTCC
CATGTCACTGTGGTTATATTGTTCTTTGGTCCATGTGTCTTCATCTATTCGAGGCCTTCT
GATACCCTGCCTGTAGACAAGATGATAGCTGTGTTCTACACGGTGATAACTCCCCTCCTC
AATCCTCTCATCTACTCCCTGAGAAATGCAGAAGTGAAGAAAGCCATGAAGAATCTATGG
TTCCGGATAATGAAAGCAGATGAGAAA


Conceptual translation

MAHLLNVTEFIFLGLSPNKEGQRVCFVLFLLLYMAIVLGNLLMVVTVAASRNLGSPMYFF
LSFLSFVEICYSSTTAPKLIFDLLAEKKSISVWGCMTQLFFMHFFGGTEIFLLTMMAYDR
YVAICKPLHYTSIMNQQVCAVLVGSAWIGGFVHSFSQILLILPLSFCGPNVIDHYFCDLL
PVLKLACSDTFLIGLLIVVNGGTLSVISFVVLLASYLVILFHLRTQSAEGRRKALSTCGS
HVTVVILFFGPCVFIYSRPSDTLPVDKMIAVFYTVITPLLNPLIYSLRNAEVKKAMKNLW
FRIMKADEK