Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51a7 Olfactory Receptor

Gene Symbol Or51a7
Organism Rat
Family 51
Subfamily a
Pseudo No
Location chr1:168136959-168137924 (+)
Aliases Olr68, Olr68

Sequence information


Nucleotide sequence

ATGGTTTCAGATACAGCTCCTGTCCCCACGCATGTCTGTTTTCAACACTCTGAGGTCAAG
TATTTTCTTCTAATTGGGATCCCAGGACTGGAATATGCCCATGCATGGATCTCCATCCCC
ATCTGCCTCATGTACCTTATTGCCATCATGGGCAACTGCACTATCATTTTTGTCATCAAG
ACAGAGCCTTCCCTTCATGAACCCATGTACTATTTCCTTACCATGTTGGCTGTCTCTGAT
ATGGGTTTGTCCTTCTCTTCCCTTCCTACCATGCTTAAGATCTTCTGTTTCAATGCCATG
CAAATCTCACCCAATGCCTGTTTTGCTCAAGAGTTCTTTATCCATGTATTCACTGCCATG
GAGTCCTCTGTGCTTCTGATTATGTCTTTGGACCGCTTTCTTGCCATTCACAACCCCTTA
AGGTACAGTTCTATCCTCACTGGCAGTAGGGTTGCTAAAATAGGGTTAATTTTAGCCATC
AGGAGCACAGCTTTGGTGCTTCCATTCCCTTTCACACTAAGGAAACTGAAATACTGTCAA
AAGAATCTGCTCTCTCACTCATACTGCCTTCATCAGGACGTCATGAAACTGGCCTGCTCT
GATAACAAGATCAATTTCATCTATGGCTTCTTCGTGGCTCTCTGTACTATGCTGGACTTT
GCCTTGATTCTTATGTCTTACATGCTGATCTTGAAGACAGTTCTCAGTATTGCATCTCTG
GCAGAAAGGCTGAAGGCCCTAAATACCTGTGTCTCCCACATCTGTGCTGTGCTCATCTTC
TATGTCCCCATCATCACCTTGGCTGCCATACATCGCTTTGCCAAGCACAAAAGCCCCCTA
CTTGTAATCCTTATTGCAGATATGTTCTTGTTGGTGCCACCCCTCATGAACCCCATTGTG
TACTGTATAAAGACTCGACAAATCCGGGAGAAGGTCTTGGGAAAGTTGGTTAACTTATGT
GTGAGA


Conceptual translation

MVSDTAPVPTHVCFQHSEVKYFLLIGIPGLEYAHAWISIPICLMYLIAIMGNCTIIFVIK
TEPSLHEPMYYFLTMLAVSDMGLSFSSLPTMLKIFCFNAMQISPNACFAQEFFIHVFTAM
ESSVLLIMSLDRFLAIHNPLRYSSILTGSRVAKIGLILAIRSTALVLPFPFTLRKLKYCQ
KNLLSHSYCLHQDVMKLACSDNKINFIYGFFVALCTMLDFALILMSYMLILKTVLSIASL
AERLKALNTCVSHICAVLIFYVPIITLAAIHRFAKHKSPLLVILIADMFLLVPPLMNPIV
YCIKTRQIREKVLGKLVNLCVR