Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51a7b Olfactory Receptor

Gene Symbol Or51a7b
Organism Rat
Family 51
Subfamily a
Pseudo No
Location chr1:168117475-168118461 (+)
Aliases Olr67, Olr67

Sequence information


Nucleotide sequence

ATGATTTTTTTTTTTGTTACATGGTTTCAGATACAGCTCCTGTCCCCACGCATGTCTGTT
TTCAACAACTCTGAGGTCAAGTATTTTCTTCTAATTGGGATCCCAGGACTGGAATATGCC
CATGCATGGATCTCCATCCCCATCTGCCTCATGTACCTTATTGCCATCGTGGGTAACTGC
ACTATCATTTTTGTCATCAAGACAGAGCCTTCTCTTCATGAACCCATGTACTATTTCCTT
ACCATGTTGGCTGTCTCTGATATGGGTTTGTCCTTCTCTTCCCTTCCTACCATGCTTAAG
ATCTTCTGTTTCAATGCCATGCAAATCTCACCCAATGCCTGTTTTGCTCAAGAGTTCTTT
ATCCATGTATTCACTGCCATGGAGTCCTCTGTGCTTCTGATTATGTCTTTGGACCGCTTT
CTTGCCATTCACAACCCCTTAAGGTACAGTTCTATCCTCACTGGCAGTAGGGTTGCTAAA
ATAGGGTTAATTTTAGCCATCAGGAGCACAGCTTTGGTGCTTCCATTCCCTTTCACACTA
AGGAAACTGAAATACTGTCAAAAGAATCTGCTCTCTCACTTATACTGCCTTCATCAGGAC
GTCATGAAACTGGCCTGCTCTGATAACAAGATCAATTTCATCTATGGTTTCTTTGCGGCT
CTCTGTACTATGCTGGACTTTGCCTTGATTCTTATGTCTTACATGCTGATCTTGAAGACA
GTTCTCAGTATTGCATCTCTGGTAGAAAGGCTAAAAGCCCTAAATACCTGTGTCTCCCAC
ATCTGTGCTGTGCTCATCTTCTATGTCCCCATCATCACCTTGGCTGCCATACATCGCTTT
GCCAAGCACAAAAGCCCCCTACTTGTAATCCTTATTGCAGATATGTTTTTGTTGGTGCCA
CCCCTGATGAACCCCATTGTGTACTGTATAAAGACTCGACAAATCCGGGAGAAGGTCTTG
GGAAAGTTGGTTAACTTATGTGTGAGA


Conceptual translation

MIFFFVTWFQIQLLSPRMSVFNNSEVKYFLLIGIPGLEYAHAWISIPICLMYLIAIVGNC
TIIFVIKTEPSLHEPMYYFLTMLAVSDMGLSFSSLPTMLKIFCFNAMQISPNACFAQEFF
IHVFTAMESSVLLIMSLDRFLAIHNPLRYSSILTGSRVAKIGLILAIRSTALVLPFPFTL
RKLKYCQKNLLSHLYCLHQDVMKLACSDNKINFIYGFFAALCTMLDFALILMSYMLILKT
VLSIASLVERLKALNTCVSHICAVLIFYVPIITLAAIHRFAKHKSPLLVILIADMFLLVP
PLMNPIVYCIKTRQIREKVLGKLVNLCVR