Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51b6 Olfactory Receptor

Gene Symbol Or51b6
Organism Rat
Family 51
Subfamily b
Pseudo No
Location chr1:169074475-169075419 (+)
Aliases Olr132, Olr132

Sequence information


Nucleotide sequence

ATGCCTACAATGTGGCTCAACATTTCCTCTTCCCCATTCCTGCTCACTGGCTTCCCAGGT
CTGGAGAAAGCCCATCATCTAATCTCCCTCCCATTACTGATGGCTTATATCTCCATACTG
CTTGGCAATGGCACCCTCCTTTTCCTCATTAAGGATGACCATAACCTCCATGAACCCATG
TACTATTTCTTAGGTATGTTGGCAGCTACGGATCTTGGAGTAACATTGACCACCATGCCC
ACAGTGCTGGGTGTACTGTGGTTAAATCACAGGGAAATTGGCCATGGAGCCTGCTTCTCT
CAGGCCTACCTTATCCACACTCTGTCTATTGTGGAGTCAGGGGTCTTGCTTGCCATGGCC
TATGATCGTTTCATTGCCATTCGCAACCCATTAAGGTATACAACCATCCTTACTGATACT
AGGGTAATAAAGATTGGCATAGGTGTAGTGATGAGGGCTGGTCTGTCAATCATGCCAATA
ATCATTCGCCTGTATTGGTTTCCCTATTGTCGATCCCATGTACTCTCCCATGCTTTCTGT
CTACACCAAGATGTCATCAAACTAGCCTGTGCTGACATCTCATTCAATCGTCTCTATCCA
GTTGTGGTTGTGTTTGCAATGGTCCTGCTAGACTTCCTGGTCATCTTCTTTTCCTATATT
TTAATTCTCAAGACTGTCATGGGCATTGCTTCTACAGATGAGCGGGCCAAGGCCCTCAAC
ACATGTGTCTCCCATATCTGTTGCATCTTGGTCTTCTATGTCACTGTGGTTGGTCTGACA
TTTATTCACAGATTTGGAAAGCATGTTCCTCATGTGGTCCACATCACAATGAGCTACATC
TACTTCCTTTTTCCCCCTTTTATGAACCCTGTCATCTATAGCATTAAGACCAAACAGATT
CAGAGTGGTTTGCTTCGCTTATTCTCCCTGCCTTGGTCTAAAACA


Conceptual translation

MPTMWLNISSSPFLLTGFPGLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPM
YYFLGMLAATDLGVTLTTMPTVLGVLWLNHREIGHGACFSQAYLIHTLSIVESGVLLAMA
YDRFIAIRNPLRYTTILTDTRVIKIGIGVVMRAGLSIMPIIIRLYWFPYCRSHVLSHAFC
LHQDVIKLACADISFNRLYPVVVVFAMVLLDFLVIFFSYILILKTVMGIASTDERAKALN
TCVSHICCILVFYVTVVGLTFIHRFGKHVPHVVHITMSYIYFLFPPFMNPVIYSIKTKQI
QSGLLRLFSLPWSKT