Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51i2 Olfactory Receptor

Gene Symbol Or51i2
Organism Rat
Family 51
Subfamily i
Pseudo No
Location chr1:169240508-169241443 (+)
Aliases Olr143, Olr143

Sequence information


Nucleotide sequence

ATGGCGCTTTTCAATGTCACTCGCCCTGCCTCCTTTCTCCTGACTGGTATCCCTGGTCTG
GAGAGCCTCCACCCCTGGCTGGCAGTGCCCCTTTGTGTGATGTATGCTGTGGCCCTCGGG
GCAAACACTGTGATCCTGCAGGCTGTGCGAGTGGAGCCTAGCCTCCATGCTCCCATGTAC
TACTTCCTGTCCATGTTGTCTTTCAGTGATGTGGCCATGTCCATGGCCACACTGCCCACT
GTGCTCAGAACCTTCTGCCTTGATGCACGCAGCATTGCTTTTGAGGCCTGTCTAGTCCAG
ATGTTTCTCATTCATTCTTTCTCGATGATGGAGTCAGGGATACTGCTGGCTATGAGTTTT
GACCGCTATGTGGCCATATGCGATCCCTTGCATTATGCCACTGTTCTCACCAATGAATTC
ATTGCTGGGATGGGGTTAGCTGTGACTGCTCGAAGCTTCATCACCCTTTTCCCTCTGCCC
TTCCTCATCAAGAGGCTACCTATATGCAGATCCAATGTTCTTTCCCACTCCTACTGCCTG
CATCCAGACATGATGAAGCTTGCCTGTGCTGACATCACCATCAACAGTATCTATGGGCTC
TTTGTTCTTGTGTCTACTTTTGGCATGGACCTGCTTTTTATTTTCCTCTCCTATGTGCTC
ATTCTGCGTTCTGTTATGGCCATTGCTTCTCATGAGGAACGCCTTAAAGCTCTCAACACA
TGTGTGTCACATATCTTGGCTGTACTTGCATTTTATGTGCCAATGATAGGGGTCTCTACA
GTCCACCGTTTTGGGAAGCATGCTCCACGATACATACATGTCCTTATGTCCAATATCTAC
CTTTTTGTGCCTCCTGTACTTAACCCTCTTATTTATAGTGCCAAGACAAAGGACATCCGC
CGTGCCATATTCCGTATGTTTCACCGTATCAAACTA


Conceptual translation

MALFNVTRPASFLLTGIPGLESLHPWLAVPLCVMYAVALGANTVILQAVRVEPSLHAPMY
YFLSMLSFSDVAMSMATLPTVLRTFCLDARSIAFEACLVQMFLIHSFSMMESGILLAMSF
DRYVAICDPLHYATVLTNEFIAGMGLAVTARSFITLFPLPFLIKRLPICRSNVLSHSYCL
HPDMMKLACADITINSIYGLFVLVSTFGMDLLFIFLSYVLILRSVMAIASHEERLKALNT
CVSHILAVLAFYVPMIGVSTVHRFGKHAPRYIHVLMSNIYLFVPPVLNPLIYSAKTKDIR
RAIFRMFHRIKL