Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51l1 Olfactory Receptor

Gene Symbol Or51l1
Organism Rat
Family 51
Subfamily l
Pseudo No
Location chr1:168237938-168238894 (+)
Aliases Olr78, Olr78

Sequence information


Nucleotide sequence

ATGAGGCTCACCATGCTTTCCTGGAATAGTAGTGATGTTACAGGGCCCATATTTATCCTG
AAGGGTTTCCCTGGACTGGAGTATGTCCATACTTGGCTCTCAGTGCCTTTCTGCCTTGCT
TATTTGGTAGCCTTCATTGGTAATGTAACCATTCTCTCTGTTATTTGGATAGAGTCCTCA
CTCCATCAGCCCATGTACTACTTCCTGTCCATCTTGGCACTGACTGACCTAGGTATGTCC
ATGTCCACACTTCCAACAATGCTGACTGTGCTGTGGTTGGATATCCGAGAGATACAGGCG
AGTGCTTGCTACGCTCAGTTGTTCTTCATCCATACATTCACATTTCTGGAGTCCTCAGTG
CTTCTGGCTATGGCCTTTGACCGTTTCATAGCAATCTGTCGTCCACTGCACTATTCTACC
ATCCTCACCAACAGTGTGATTGGCAAAATTGGTATGGCCTGCTTGCTTCGAAGCATGGGG
GTTGTTCTGCCTACACCTTTGCTACTGAGACAGTATCACTATTGCCACATCAATGCCCTC
TCCCATGCCTTCTGCTTACACCAAGATGTTCTGAGGCTATCCTGCTCTGATGCCAGGATC
AACAGTGTCTATGGACTATGTGTAGTTATTGCTACACTAGGTGTGGATTCAGTCTTCATA
CTTATTTCTTATGTTCTTATTCTGAACGCCGTGCTGAGTATCGCATCCCGTGAAGAGCGA
CTAAAAGCTCTGAACACCTGTGTTTCCCATGTCTGTGTGGTGCTCATCTTCTTTGTACCA
GTAATTGGGGTGTCAATGGTCCATCGCTTCGGGAAACATCTCTCTCCCATAGTCCACATC
CTCATGGCTGACATCTACCTGCTTCTCCCCCCAGTGCTTAACCCAGTTGTCTACAGTGTG
AGGACAAAACAGATCCGCCTAGGAATTCTCCGCAAGTTTAGATTAAGTAGAAGGTTT


Conceptual translation

MRLTMLSWNSSDVTGPIFILKGFPGLEYVHTWLSVPFCLAYLVAFIGNVTILSVIWIESS
LHQPMYYFLSILALTDLGMSMSTLPTMLTVLWLDIREIQASACYAQLFFIHTFTFLESSV
LLAMAFDRFIAICRPLHYSTILTNSVIGKIGMACLLRSMGVVLPTPLLLRQYHYCHINAL
SHAFCLHQDVLRLSCSDARINSVYGLCVVIATLGVDSVFILISYVLILNAVLSIASREER
LKALNTCVSHVCVVLIFFVPVIGVSMVHRFGKHLSPIVHILMADIYLLLPPVLNPVVYSV
RTKQIRLGILRKFRLSRRF