Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51q1d Olfactory Receptor

Gene Symbol Or51q1d
Organism Rat
Family 51
Subfamily q
Pseudo No
Location chr1:169153297-169154259 (+)
Aliases Olr137, Olr137

Sequence information


Nucleotide sequence

ATGTTGCATACATCAAGTATGTCAGAAGTAACTAACACTACTCATGATCCTTTCTACTTC
ATCCTCACGGGCATCCCAGGATTTGAGGCTATCCATCTCTGGATCTCCATCCCCTTCTTC
TGCCTCTACACCATTTCCATCATGGGCAACACCACCATCCTCACCGTCATCCGCACAGAG
CCATCTCTCCACCAGCCCATGTACCTCTTCCTCTCCATGCTGGCCCTCACTGACCTGGGC
CTCACTCTCACCACACTCCCTACTGTCATGCAGCTTCTCTGGTTCAACATTCGGGAAATC
AGCTTTGAGGCCTGCTTTGCACAGTTATTCTTCCTCCACGGGTTCTCCTTCATGGAATCA
TCTGTTTTATTGGCCATGTCCTTTGACCGTTATGTGGCCATCTGCCGCCCACTCCACTAT
GCCTCCATCCTCACCAGTGAGGTCATTGGTAGAATAGGGTTGGCCATCATTTGCCGCTGT
GTCCTGGCTGTTCTTCCCTCCCTTTTCCTGCTCAAGCGCCTGCCCTTCTGCCATTCCCAC
CTTCTTTCTCACTCTTACTGCCTCCATCAGGATATGATTCACCTGGTCTGTGCTGACATC
AGGGTCAACAGTTGGTATGGATTTACTCTGATCCTGCTCATTACTGTATTAGACCCTCTG
CTCATTGTACTCTCCTATGCACTTATCCTGAAAAGTGTCTTGAACACAGCCACTTGGGTT
GAACGTCTCCGGGCTCTCAACAACTGTCTGTCCCACATGCTGGCAGTTCTGGTTCTCTAT
GTACCCATGGTTGGTGTGTCTGTGACTCACCGCTTTGCTAAGCATGTCTCTCCACTGGTC
CATGTTCTCATGGCCAATATCTACCTGCTGGCACCTCCTGTGATGAACCCCATCATTTAC
AGTGCAAAGACCAAGCAGATTCGCCAGGGAATCACTCGACTTCTGTTCCAAAGAAAGATT
CAC


Conceptual translation

MLHTSSMSEVTNTTHDPFYFILTGIPGFEAIHLWISIPFFCLYTISIMGNTTILTVIRTE
PSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQLFFLHGFSFMES
SVLLAMSFDRYVAICRPLHYASILTSEVIGRIGLAIICRCVLAVLPSLFLLKRLPFCHSH
LLSHSYCLHQDMIHLVCADIRVNSWYGFTLILLITVLDPLLIVLSYALILKSVLNTATWV
ERLRALNNCLSHMLAVLVLYVPMVGVSVTHRFAKHVSPLVHVLMANIYLLAPPVMNPIIY
SAKTKQIRQGITRLLFQRKIH