Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52a5 Olfactory Receptor

Gene Symbol Or52a5
Organism Rat
Family 52
Subfamily a
Pseudo No
Location chr1:168904715-168905659 (-)
Aliases Olr127, Olr127

Sequence information


Nucleotide sequence

ATGATCAAGTTCAATGGCTCAGTCTTCATGCCTTCTGTACTAACATTAGTGGGGATCCCT
GGCCTGGAGTCAGTGCAGTGCTGGATTGGGATTCCATTCTGTGTCATGTACATCATTGCT
ATGATTGGGAACTCTCTAATTTTAGTTATAATCAAAAGCGAAAAGAGCCTCCACATACCC
ATGTATATTTTCTTGGCCATTTTGGCAGTCACAGACATTGCCCTTAGCACTTGCATTCTT
CCCAAAATGTTGGGCATCTTTTGGTTTCACATGCCACAAATTTTCTTTGATGCTTGCCTG
CTGCAGATGGAACTCATCCACTCATTCCAGGCCACAGAGTCAGGCATTCTCCTGGCCATG
GCTCTGGATCGCTATGTGGCCATCTGCAACCCCCTGAGACATGCTACTATCTTCTCTCCA
CAACTCACAACTTGCCTTGGAGCTGGTGCATTACTCAGGGCTTTCATTCTTGTATCCCCG
TCCATAATACTTATCAAATGTCGCCTTAAATACTACAGAACTACCAATATCTCCCACTCT
TACTGTGAACACATGGCTATTGTGAAATTGGCAGCTCAAGATATCAGAATCAACAAGATA
TGTGGCCTCCTTGTTGCCTTTGCTATCTTGGGGTTTGACATAGTCTTCATTACCTTCTCC
TATGTGCGAATCTTCATCACCGTCTTCCAGCTGCCCCAGAAGGAGGCTCGATTGAAAGCT
TTCAATACCTGCATTGCTCACATCTGTGTCTTCCTACAGTTCTACCTTCTGGCCTTCTTC
TCTTTCTTCACACACAGGTTTGGGGCTCACATACCCTCCTATGTGCATATCCTCCTGTCA
GATCTTTACCTGTTAGTCCCACCTTTTCTGAATCCCATTGTTTATGGTGTTAAAACTAAA
CAAATCCGTGACCAAGCCTTGAAAATGCTTTTCTCCAAGAAATAT


Conceptual translation

MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIP
MYIFLAILAVTDIALSTCILPKMLGIFWFHMPQIFFDACLLQMELIHSFQATESGILLAM
ALDRYVAICNPLRHATIFSPQLTTCLGAGALLRAFILVSPSIILIKCRLKYYRTTNISHS
YCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFSYVRIFITVFQLPQKEARLKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGAHIPSYVHILLSDLYLLVPPFLNPIVYGVKTK
QIRDQALKMLFSKKY