Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52a5b Olfactory Receptor

Gene Symbol Or52a5b
Organism Rat
Family 52
Subfamily a
Pseudo No
Location chr1:168882639-168883586 (-)
Aliases Olr126, Olr126

Sequence information


Nucleotide sequence

ATGATCAAGTTCAATGGCTCAGTCTTCATGCCTTCTGTACTAACATTAGTGGGGATCCCT
GGCCTGGAGTCAGTGCAGTGCTGGATTGGGATTCCATTCTGTGTCATGTACATCATTGCT
ATGATTGGGAACTCTCTAATTTTAGTTATAATCAAAAGCGAAAAGAGCCTCCACATACCC
ATGTATATTTTCTTGGCCATTTTGGCAGTCACGGATATTGTCCTTAGCACGTGCATTCTT
CCCAAAATGTTGGGCATCTTTTGGTTTCACATGCCACAGATATCCTTTGATGCTTGCCTG
CTGCAGATGGAACTCATCCACTCATTCCAGGCCACAGAGTCAGGCATTCTCCTGGCCATG
GCTCTGGATCGCTATGTGGCCATCTGCAACCCCCTGAGACATGCTACTATCTTCTCTCCA
CAACTCACGACTTGCCTTGGAGCTGGTGTCCTACTCAGGTCTCTCATTCTCACATTCCCA
ATGATATTGCTCATCAAATGTCGCCTCGAATACTACAGAACTACCGTTATCTCCCACTCT
TACTGTGAACACATGGCTATTGTGAAATTGGCAGCTCAAGATATCAGAATCAACAAGATA
TGTGGCCTCCTTGTTGCCTTTGCTATCTTGGGGTTTGACATAGTCTTCATTACCTTCTCC
TATGTGCGAATCTTCATCACCGTCTTCCAGCTGCCCCAGAAGGAGGCTCGATTGAAAGCT
TTCAATACCTGCATTGCTCACATCTGTGTCTTCCTACAGTTCTACCTTCTGGGTTTCTTC
TCTTTCTTCACACACAGGTTTGGGGCTCACATACCCTCCTATGTGCATATCCTCCTGTCA
GATCTTTACCTGTTAGTGCCACCTTTTCTGAATCCCATTGTTTATGGTGTTAAAACTAAA
CAAATCCGTGACCAAGTCTTTAAAATGCTTTTCTCCAAGAAACCTCTG


Conceptual translation

MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIP
MYIFLAILAVTDIVLSTCILPKMLGIFWFHMPQISFDACLLQMELIHSFQATESGILLAM
ALDRYVAICNPLRHATIFSPQLTTCLGAGVLLRSLILTFPMILLIKCRLEYYRTTVISHS
YCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFSYVRIFITVFQLPQKEARLKA
FNTCIAHICVFLQFYLLGFFSFFTHRFGAHIPSYVHILLSDLYLLVPPFLNPIVYGVKTK
QIRDQVFKMLFSKKPL