Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52b6-ps Olfactory Receptor

Gene Symbol Or52b6-ps
Organism Rat
Family 52
Subfamily b
Pseudo Yes
Location chr1:169401805-169402971 (+)
Aliases Olr151-ps, Olr151-ps

Sequence information


Nucleotide sequence

GAGCAGGGCTGTGTCTGTTTACAAGCCTGCTTACACTCTGACAAGTGTGGTCAAAACCTG
AGTGTGTTTTCCTTCTTTGACACAGGCTCTGCACAATGCCATGGCTTTCTTACCTTCTTA
CAGTGTGGCTGCTGTGAACAACTCTGACACTCGAGCGACAGGCTGCCTCCTCACTGGCAT
CCCTGGGCTGGAGCACCTACATGTGTGGCTGTCCATTCCCTTCTGTACTATGTACATAGC
TGCCCTGATAGGCAATGGTGTTCTAATCTGTGTCGTCCTCTCCCAGCCAAGCCTCCACGA
GCCCATGTACATTTTCCTGTCTATGCTGGCCAGTGCCTACCTCCACGATGCCCAAGACCC
TGGCCAACTTCTGGCTAGGTTCTAGCCACATCTCCTTTGACGGCTGCCTGACTCAGATGT
TCTTCATCCACTTCCTTTTCGTGGCTGACTCTGCTGTCCTGCTGGCCATGGCTTTTGACC
GCTATGTGGCAATATGCTCTCCTCTGCGCTACACCACCATCCTGACCAGGCAGGTCATGG
GAAAGATGGCTGCTGCTACCCTGACACGCAGTTTTATAATCATGTTCCCATCCATCTTTC
TCCTCAAGAGGCTGCACTACTGCCGGATCAATATCATTCAACATACCTTCTGTGAGCACA
TGGGTATCGCCCGGCTGTCCTGCTCTGACATTTCCATTAACGTCTGGTATGGACTGGCAG
CTGCTCTTCTCTCTACAGGCCTGGACATCATTCTCATCGCTGTTTCCTATGTCCACATCC
TCCGAGCGGTTTTCCGCCTCTCTTCCCAAGAAGCCAGGTCCAAGGCCCTGAGTACTTGTG
GATCCCATGTCTGTGTCATCCTGCTTTTCTATATCCCAGCCCTCTTCTCTGTCTTTGCCT
ACAGGTTTGGTGGGAAACGCATCCCACGTTATGTCCACATCCTGCTGGCCAACCTCTACG
TGGTCATCCCGCCTATGCTTAAGCCTGCGATTTATGGAGTAAGAACAAAGCAGATACTGG
AAGGAGCTAAGCAAATGTTTGCGAATATCAGCAAGGAATTTAAATAAATGCACACAATTT
GGCCTCAGCCGACTCATTTTCTGCATCTATCAAATCCCCCGTATTTGCCGAATCCTTGCA
TCTACACCTCTATGATTCTCGTCCAAA


Conceptual translation

VAAVNNSDTRATGCLLTGIPGLEHLHVWLSIPFCTMYIAALIGNGVLICVVLSQPSLHEP
MYIFLSMLASA\STMPKTLANFWLGSSHISFDGCLTQMFFIHFLFVADSAVLLAMAFDR
YVAICSPLRYTTILTRQVMGKMAAATLTRSFIIMFPSIFLLKRLHYCRINIIQHTFCEHM
GIARLSCSDISINVWYGLAAALLSTGLDIILIAVSYVHILRAVFRLSSQEARSKALSTCG
SHVCVILLFYIPALFSVFAYRFGGKRIPRYVHILLANLYVVIPPMLKPAIYGVRTKQILE
GAKQMFANISKEFK