Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52d1 Olfactory Receptor

Gene Symbol Or52d1
Organism Rat
Family 52
Subfamily d
Pseudo No
Location chr1:169305175-169306200 (+)
Aliases Olr148, Olr148

Sequence information


Nucleotide sequence

ATGAGCCTGATAACAAATGTTTCAGGGCAGGCATGCTGTCACCCCATGGATAGAGCCATG
CATGTGCCAAGGCGAACAACAGGCTCCAACATGAGCGACAGTCTCCCAGTAACTCTCTTC
CTGACTGGGATCCCAGGGCTGGAGTTTGCCCACCTCTGGATTGCTATCCCTTTCTGTGTC
ATGTATCTCATAGCTCTGCTTGGTAATGCTGCCCTCATCCTTATCATAGGGACAGAGAGT
GCCCTTCATGCACCCATGTACCTCTTCCTCTGCCTTCTCTCACTCACTGACCTGGCTCTC
AGCTCCACCACTGTACCTAAAATGTTGGCTATTTTATGGCTCAATGCTAATGAGATTTCC
TTTGGTGGATGCCTAGCTCAAATGTTTTGTGTCCACTCCATCTATGCTCTTGAGTCCTCG
GTTCTCCTTGCCATGGCCTTTGATCGATATGTTGCTATCTGCAACCCACTGAGATATACA
ACCATCCTCAACCATACTGTCATAGCCCAAATTATCTTTGCTGGCATAGTCCGTAGTGTG
GCTATTGTCTCCCCTTTCATCTTTTTGCTGAGGCGACTGCCCTACTGTAGTCACCGTGTC
ATGGCTCACACATACTGTGAGCATATGGGCATTGCTAGGCTTGCCTGTGCCAACATCACT
GTCAACATTGTCTATGGGCTGACTGTGGCTCTGCTGGCCATGGGCCTGGATTCCATCCTC
ATTGCCATCTCCTATGGCTTCATCCTCCGGGCTGTCTTCCGTCTCCCATCCCGTGACGCT
CAACACAAGGCTCTGAGTACCTGTGGATCTCACCTTGGTGTCATCTTGGTTTTCTATATA
CCTGCTTTCTTCTCCTTTCTTACCCACCGTTTTGGTCACAACCGAGTTCCCAAAAATGTA
CACATCTTCCTGGCTAACCTCTATGTGCTGGTGCCTCCTGTACTCAATCCCATCATCTAT
GGAGCAAGAACGAAGGAGATTCGGAGTCGGCTTGTAAAACTGTTTCACTTGGGAAAAGAC
TTGGTA


Conceptual translation

MSLITNVSGQACCHPMDRAMHVPRRTTGSNMSDSLPVTLFLTGIPGLEFAHLWIAIPFCV
MYLIALLGNAALILIIGTESALHAPMYLFLCLLSLTDLALSSTTVPKMLAILWLNANEIS
FGGCLAQMFCVHSIYALESSVLLAMAFDRYVAICNPLRYTTILNHTVIAQIIFAGIVRSV
AIVSPFIFLLRRLPYCSHRVMAHTYCEHMGIARLACANITVNIVYGLTVALLAMGLDSIL
IAISYGFILRAVFRLPSRDAQHKALSTCGSHLGVILVFYIPAFFSFLTHRFGHNRVPKNV
HIFLANLYVLVPPVLNPIIYGARTKEIRSRLVKLFHLGKDLV