Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52h1 Olfactory Receptor

Gene Symbol Or52h1
Organism Rat
Family 52
Subfamily h
Pseudo No
Location chr1:169371590-169372537 (-)
Aliases Olr149, Olr149

Sequence information


Nucleotide sequence

ATGATTACCTATAACGTGAGCAGTTACAACCCAGGGCCCTTCCTTTTGGTGGGGATCCCA
GGCTTGGAGCAATTCCATGTGTGGATTGGCATTCCCTTCTGTGTGATCTACGTCATAGCT
ATGACGGGAAACTGTGTCCTTCTCTACCTCATCGTAGCGGAGCGGAGCCTTCACGAGCCC
ATGTTTTTTTTCCTGTCCATGCTGGCATTGACCGATCTCATCTTGTCCACAGCTGGTGTG
CCTAAAACACTCAGCATCTTCTGGATGGGGGCTCGAGAAATCACGTTCCCAGGCTGCCTC
ACCCAAATGTTCTTCCTCCACTACAGCTTTGTCCTGGACTCAGCCATTCTAATGGCCATG
GCCTTTGATCGCTACGTGGCCATCTGCTCACCCTTGAGATATGCTACCGTCTTGACCCCC
AAGACTATTATCAAGATTGCTGTGGGCATCTCCTTTCGAAGTTTCTGTATCATCTTGCCA
GATGTATTCTTGTTGACACGTTTACCTTTCTGTAGGACACGCATCATACCTCACACCTAC
TGTGAGCACATAGGTGTTGCCCGGCTTGCATGTGCAGATATCTCCATCAACATCTGGTAT
GGATTTTGTGTCCCCATCATGACAGTCATCTCAGATGTGGTCCTCATTGCTGTGTCTTAC
ACCCTCATCCTATGTGCCGTTTTTCGCCTCCCCTCCAGAGATGCACGCCAGAAAGCCCTG
GGCACCTGTGGTTCCCATGTCTGTGTCATCCTCATGTTTTACATACCTGCCTTTTTCTCC
ATCCTTGCTCATCGCTTTGGACACAATGTGTCCCTCACGTTCCACATCATGTTCGCCAAT
CTCTACATTGTTATTCCACCAGCAATGAACCCTATTGTCTACGGAGTGAAAACCAAGCAG
ATCAGAGATAAGGTCATCCTTTTATTCTCTGTCAAGAGCACAGAAGGT


Conceptual translation

MITYNVSSYNPGPFLLVGIPGLEQFHVWIGIPFCVIYVIAMTGNCVLLYLIVAERSLHEP
MFFFLSMLALTDLILSTAGVPKTLSIFWMGAREITFPGCLTQMFFLHYSFVLDSAILMAM
AFDRYVAICSPLRYATVLTPKTIIKIAVGISFRSFCIILPDVFLLTRLPFCRTRIIPHTY
CEHIGVARLACADISINIWYGFCVPIMTVISDVVLIAVSYTLILCAVFRLPSRDARQKAL
GTCGSHVCVILMFYIPAFFSILAHRFGHNVSLTFHIMFANLYIVIPPAMNPIVYGVKTKQ
IRDKVILLFSVKSTEG