Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52j3b Olfactory Receptor

Gene Symbol Or52j3b
Organism Rat
Family 52
Subfamily j
Pseudo No
Location chr1:168293741-168294676 (+)
Aliases Olr81, Olr81

Sequence information


Nucleotide sequence

ATGACAATTCAGAGTAACAGGAGTGTTTTTCACCCAGCTACATTTTTCCTCATTGGGATT
CCAGGTTTGGAGGAAATCCATGCTTGGATCTCTCTGCCTTTCTGCTGTATTTATCTTGTG
GCCCTAGTGGGAAATACCATGATCCTGGTAGTTATCAAGACAGGGCGTTCTCTCCGAGAG
CCCATGTTCTACTTCCTGGCCATCCTTTCTTCAGTCGACTTGGCTCTTTCTACAACTTCT
GTGCCCCGTATGCTTGGCATATTTTGGTTTGATGCCCATGAAATAAACTTTGGTGGCTGT
GTGGCTCAGATGTTTTTGATCCATGCCCTCACTGGCATGGAGGCTGAGGTTCTCATGGCC
ATGGCTTTTGACCGTTATGTAGCCATCTGTGTTCCACTCCACTACACAACCATCTTGACA
TCTCATGTCCTGATGGGCATCAGTATATGTGTGGTAGTTCGTCCAACCTTGTTTATATGC
CCAATGATCTATCTCATTTACCGCTTACCCTTTTGTCAAGCTCATGTAATAGCACATTCC
TATTGTGAACACATGAGCATTGCCAAACTGTCCTGTGGAAACATCCATATCAATGCTGTG
TATGGCCTCTTTGTGGTCTCTTTCTTTCTTTTGAACTTGGTACTTATTGGCATCTCATAT
GGATACATTCTTCATGCTGTGTTCCGCCTCCCATCTCATGATGCACGGTTAAAAGCCCTC
AGCACATGTGGTTCCCATGTGGCTGTTCTCTGTGTTTTCTACATCCCATCAGTCTTCTCT
TTCCTCACTCATCGGTTTGGACACAACATTCCACATTACATTCACATTCTTGTTGCCAAC
CTCTATTTGGTCATTCCTCCCTTTCTCAATCCCATCATTTATGGTGTGAGAACAAAGCAG
ATAAGAGAGCGTGTTCTCCACATATTCACTAAAAGG


Conceptual translation

MTIQSNRSVFHPATFFLIGIPGLEEIHAWISLPFCCIYLVALVGNTMILVVIKTGRSLRE
PMFYFLAILSSVDLALSTTSVPRMLGIFWFDAHEINFGGCVAQMFLIHALTGMEAEVLMA
MAFDRYVAICVPLHYTTILTSHVLMGISICVVVRPTLFICPMIYLIYRLPFCQAHVIAHS
YCEHMSIAKLSCGNIHINAVYGLFVVSFFLLNLVLIGISYGYILHAVFRLPSHDARLKAL
STCGSHVAVLCVFYIPSVFSFLTHRFGHNIPHYIHILVANLYLVIPPFLNPIIYGVRTKQ
IRERVLHIFTKR