Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52m2 Olfactory Receptor

Gene Symbol Or52m2
Organism Rat
Family 52
Subfamily m
Pseudo No
Location chr1:167769254-167770210 (-)
Aliases Olr47, Olr47

Sequence information


Nucleotide sequence

ATGCTCATTTCTAACAATGCCTGTTCAGTACCCAGCTCTTTCTGGCTCACCGGCATCCCA
GGACTGCAGTCCCTGCACATGTGGCTCTCCATCCCCTTTGGCTCCATGTACCTGGTGGCT
GTGGTGGGGAACATCACCATCTTGGCAGTGGTTAAGACAGAGCGCAGCCTGCACCAGCCC
ATGTATTTCTTCCTGTGTATGTTGGCTGTTATTGACTTGGTCCTATCAACTTCTACAATG
CCCAAACTATTGGCCATCTTCTGGTTTGGTGCCTGCAGAATTGGTCTAGATGCTTGCTTG
ATTCAGATGTTCTTTGTCCACTGCTTTGCTACCGTTGAGTCGGGCATCTTTCTTGCCATG
GCTTTTGACCGCTATGTGGCCATCTGTGACCCACTACACCATACATCAGTACTTACCCAT
GCAGTGGTGGGACGCTTGGGGCTGGCTGCACTTCTCCGAGGAGTATTCTACATTGGACCT
CTTCCACTCCTCATTCGCCTGAGGCTGCCCCTTTATCGGACCCACATCATTGCCCACTCA
TACTGTGAGCACATGGCTGTGGTCACTTTGGCATGTGGTGACACAAGAGCCAATAATTTA
TATGGAATGGGGATTGGTCTCCTGGTATTAATCCTAGACTCCGTAGCTATAACTGCATCT
TACGTGATGATTTTCAGGGCTGTGTTGGGATTGTCCACCTCTGATGCCAGGTTTAAAACT
TTAGGGACATGCGGTTCTCACATCTGTGCCATCCTTGTCTTCTATATTCCTATTGCTGTC
TCGTCTCTCACCCATCGCTTTGGCCGCCACGTGCCTTCCCATATCCATATTCTTTTGGCC
AACTTTTATCTCCTCATCCCACCCATCCTCAACCCAATTGTCTATGCTGTGCGTACCAAA
CAGATCCGAGAGAGACTTTTGCATATTATTAAGTCCGGAACTCAACACAGGGACATG


Conceptual translation

MLISNNACSVPSSFWLTGIPGLQSLHMWLSIPFGSMYLVAVVGNITILAVVKTERSLHQP
MYFFLCMLAVIDLVLSTSTMPKLLAIFWFGACRIGLDACLIQMFFVHCFATVESGIFLAM
AFDRYVAICDPLHHTSVLTHAVVGRLGLAALLRGVFYIGPLPLLIRLRLPLYRTHIIAHS
YCEHMAVVTLACGDTRANNLYGMGIGLLVLILDSVAITASYVMIFRAVLGLSTSDARFKT
LGTCGSHICAILVFYIPIAVSSLTHRFGRHVPSHIHILLANFYLLIPPILNPIVYAVRTK
QIRERLLHIIKSGTQHRDM