Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52n1 Olfactory Receptor

Gene Symbol Or52n1
Organism Rat
Family 52
Subfamily n
Pseudo No
Location chrUn_KL568409v1:179289-180251 (-)
Aliases Olr170, Olr170

Sequence information


Nucleotide sequence

ATGTCAATTCTAAATGTCAGCAGCCTGACTCCAGCTTCATTCATCCTCAATGGCATCCCT
GGTCTGGAAGAGGTTCATTTATGGATTTCTTTCCCACTATTTACCATGTATAGCATTGCC
CTTACAGGGAACTTTGGACTTATATATCTTATCTATTCTGAAGAGGTCTTACACAGACCT
ATGTACATCTTCTTAGCCCTTCTTTCCTTCACAGATGTGCTCATGTGCACAAGCACCGTT
CCCAACACTCTCTGCATATTGTGGTTCAATTTCAAGGAGATTGACTTTAAGGCCTGCCTG
GCTCAGATGTTCTTTGTGCACACTTTCACAGGAATGGAGTCCGGGGTGCTTATGCTTATG
GCCCTGGACCGCTATGTAGCCATCTGTTACCCTCTGCGCTATGCCACTATCCTCACTAAT
GTGGTCATCGCCAAGGCAGGGATGCTTACTTTTCTTCGGGGCGTGGCTCTCGTCATTCCC
TTCATATTCCTCACAAAGCGCTTGCCGTACTGCATGGGCAATGTCATACCCCACACCTAC
TGTGACCACATGTCTGTTGCTAAAATATCCTGTGGCAATGTTCAGATCAATGCCATCTAC
GGTTTAATGGTTGCCCTCCTGATTGGGGGCTTTGACATCCTGTGCATCACAGTTTCCTAC
ACCATGATCCTAAGGGCCGTTGTGAGTCTGTCATCGGCAGATGCGCGACAGAAAGCTTTC
AGCACCTGCACTGCTCACATATGTGCCATTGTCATCACCTACGTCCCAGCCTTTTTCACC
TTCTTTACACACCGCTTTGGGAGGCATACCATCCCTCCCCACATACATATCATTATGGCT
AATCTCTATCTACTCATGCCTCCCACCATGAACCCTATTGTGTATGGGGTGAAAACCAAG
CAGATACGAGAGAGTGTCATTAGGTTCTTGTTTAAAGGGGGAGAAAATTCTTCTCATAAA
ATT


Conceptual translation

MSILNVSSLTPASFILNGIPGLEEVHLWISFPLFTMYSIALTGNFGLIYLIYSEEVLHRP
MYIFLALLSFTDVLMCTSTVPNTLCILWFNFKEIDFKACLAQMFFVHTFTGMESGVLMLM
ALDRYVAICYPLRYATILTNVVIAKAGMLTFLRGVALVIPFIFLTKRLPYCMGNVIPHTY
CDHMSVAKISCGNVQINAIYGLMVALLIGGFDILCITVSYTMILRAVVSLSSADARQKAF
STCTAHICAIVITYVPAFFTFFTHRFGRHTIPPHIHIIMANLYLLMPPTMNPIVYGVKTK
QIRESVIRFLFKGGENSSHKI