Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or55b3 Olfactory Receptor

Gene Symbol Or55b3
Organism Rat
Family 55
Subfamily b
Pseudo No
Location chr1:167580750-167581670 (-)
Aliases Olr38-ps, Olr38-ps

Sequence information


Nucleotide sequence

ATGGATGAGGCTGGAAATACCAGGATCTTCAACTTTTCCTACAGTAGCTTCCTCTTGGTG
GGCTTCCCTGGTTTGCAAGAATGGCGAGCCCTCCTGGTCCTGCCTCTGACCTTTCTCTAT
GTGTCCATCATTTCTGCCAATGCCTTAGTCATTCATACAGTGGTGGCCCAGAGGAGTCTG
CATCAGCCCATGTACGTGCTCATTGCTCTGCTCTTGGCTGTCAACATCTGTGCTTCCACA
GCTGTAATGCCTAAAATGCTGGAAGGCTTTGTGCATTATGCTAATCCCATCTCGCTCCAT
GGCTGCCTAGCGCAAATGTTCTTTATCTACTTTACACTCTTTCTGGACTACAATCTCCTG
CTGGCCATGGCTCTAGATCGCTACGTGGCCATTTGCCACCCACTCCACTACACTGACCTG
ATGACCTCACACTTATTGGGCCTGATGGCCACTTTTGTGCTAACACGGAGCCTAGGAGTG
GCAGTGCCCCTAGTGGTACTAACTGCGAAAGCTCAATTCTGCAAGACGTCTGTCATAAGA
CACTTCACCTGCGAGTACATCGCACTGCTGAGCATAGCATGTGGAGACCTGACCTTCAAC
AACCGGTTAGGATTGGCTATGCGGTTGGTCACCGTGACTTTTGATCTGGCCTTATTGGGA
ACCTCCTATACCCGTATCATCTATGCTGCCTTCCGGATCTCTTCTGGGGGAGCCCGGGCC
AAGGCCTTGCACACTTGTGGTTCCCACTTATTGGTCATCCTCACCATCTACCTTTCTGGT
CTCTCAACTTCCATTGTCTTTCGAGTGGCCAAGACTGTGTCTCAAGATATCCAGAACCTT
CTCAGTGCCATCTACCTGCTGCTCCCAGGAGCCTTGAATCCTCTCATTTATGGGGTGAGA
ACTAAGGAATCCGGCAGCACA


Conceptual translation

MDEAGNTRIFNFSYSSFLLVGFPGLQEWRALLVLPLTFLYVSIISANALVIHTVVAQRSL
HQPMYVLIALLLAVNICASTAVMPKMLEGFVHYANPISLHGCLAQMFFIYFTLFLDYNLL
LAMALDRYVAICHPLHYTDLMTSHLLGLMATFVLTRSLGVAVPLVVLTAKAQFCKTSVIR
HFTCEYIALLSIACGDLTFNNRLGLAMRLVTVTFDLALLGTSYTRIIYAAFRISSGGARA
KALHTCGSHLLVILTIYLSGLSTSIVFRVAKTVSQDIQNLLSAIYLLLPGALNPLIYGVR
TKESGST