Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ak25 Olfactory Receptor

Gene Symbol Or5ak25
Organism Rat
Family 5
Subfamily ak
Pseudo No
Location chr3:72,817,900-72,818,800 (-)
Aliases Olr442

Sequence information


Nucleotide sequence

ATGACACAAAGAAATGCCACCGAAGTCACTGACTTCTATCTTCTGGGATTTGGAGTCCAG
CAAAATACTCAGTGTGTCCTCTTCATTGTATTTTTTGTGATCTATGTCACATCCATGGTG
GGCAACACTGGGATGATCCTCCTCATCAACACTAACTCCAGACTTCAGACTCCCATGTAC
TTCTTCTTACAAAACCTGGCTTTTGTGGATATCTGTTACACGTCTGCCATCACTCCCAAG
ATGCTGCAGAGCTTCATGGTAGAAGACTGTTCCATATCATACACAGGATGTGTAATACAA
TTGTTGGTATATGCCACATTTGCAACCAGTGACTGTTACCTACTCGCTGTTATGGCAGTG
GACCGGTATGTGGCAATCTGTAAGCCCCTCCGGTACCCGATAATCATGTCTCGACAGGTC
TGCTTACTGTTGGTCGCTCTTTCTTATCTCATGGGATCAATAAATTCCTCTGTACACACA
GGATTTACATTCTCATTGTCTTATTGTAACTCCAAAAATATCAATCACTTTTTCTGTGAT
GTTGTCCCAATCATCAGTCTTTCATGCTCGAACACTGATATTAATATCATGCTACTTATT
GTTTTTGTTGGATTTAACCTGACATTCACTGTGTTGGTCATTATCTTCTCTTACATATAC
ATCATGGCCGCCATCCTAAAGATGTCCTCTACTGCAGGGAGGAAGAAAACCTTCTCCACG
TGTGCCTCCCACCTGACAGCAGTCACCATTTTCTATGGAACCCTTTCTTATATGTACTTA
CAGCCTCATTCGGACAATTCTGAGGAGAATATGAAAGTGGCCTCTGTGTTTTATGGCATT
GTGATTCCCATGCTGAACCCTCTCATCTACAGCTTGAGAAACAAGGAAGTCAAAGAAGGT
TTTAAAGCAATGAGCAGAAGGTTCTTAAGAATGAAATCAAATCCT


Conceptual translation

MTQRNATEVTDFYLLGFGVQQNTQCVLFIVFFVIYVTSMVGNTGMILLINTNSRLQTPMY
FFLQNLAFVDICYTSAITPKMLQSFMVEDCSISYTGCVIQLLVYATFATSDCYLLAVMAV
DRYVAICKPLRYPIIMSRQVCLLLVALSYLMGSINSSVHTGFTFSLSYCNSKNINHFFCD
VVPIISLSCSNTDINIMLLIVFVGFNLTFTVLVIIFSYIYIMAAILKMSSTAGRKKTFST
CASHLTAVTIFYGTLSYMYLQPHSDNSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKEG
FKAMSRRFLRMKSNP