Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5au1 Olfactory Receptor

Gene Symbol Or5au1
Organism Rat
Family 5
Subfamily au
Pseudo No
Location chr15:28445853-28446785 (-)
Aliases Olr1638, Olr1638

Sequence information


Nucleotide sequence

ATGGAAAGAACAAACTTGAGCCAAGAGATGGAGTTTGAGCTCTTGGGCCTCACCAGTGAC
CCCCAGCTCCAAAAGCTGCTCTTTGTGGTGTTTCTGATCATGTACTCCATCACTGTGTTG
GGAAACCTGGTCATGTTCTTTCTCATCCATGTGAGTACCACTCTGCACACACCCATGTAT
TCCCTCCTCAAGAGCCTTTCCTTCCTGGATTTCTGCTACTCTTCTACGGTGGTCCCCCAG
ACACTGATGAACTTCTTGGTTCAGAGGAAGGTAATCTCTTACTTTGGCTGCATGGCTCAG
ATGTTCTTTTACGCGGGCTTCGCCACCAGCGAGTGCTACCTCATTGCCGCGATGGCCTAT
GACCGCTACGTCGCTGTTTGCAACCCACTCCTCTATCCAACCATCGTGTCTCCTAACGTC
TGTGCCTCTCTCATCGTTGGCTCCTATAGCGCCGGGTTTCTCAATTCTCTGATCCACACA
AGCTGCATCTTCAGTCTGAACTTCTGTGGTGCTCACGTGGTCACTCATTTCTTCTGCGAC
GGACCGCCCATCCTGTCCCTGTCCTGCGTGGACACTTCGCTGTGTGAGATCTTGCTCTTC
ATTTTTGCGGGCTTTAACCTTCTGAGCTGCACTCTCACCATCTTGATTTCCTACTTCTTA
ATCTTCGTCGCCATCCTCCGAATGCATTCAACCCAGGGAAGGTTCAAAGCGCTCTCCACC
TGCACTTCCCACCTCACGGCTGTGTGCTTCTTCTTTGGCACGACACTTTTTATGTACTTG
CGCCCTAGGTCCAGCTACTCCTTGACCCAGGACCGCACAGTTGCCGTGATCTACACAGTG
GTGATCCCAATGCTGAACCCCTTAATCTACTCTTTGAGAAACAAGGATGTGAAGGAGGCT
TTAAGGAGGGTTTGGGGCTGGAAATCAATGCGA


Conceptual translation

MERTNLSQEMEFELLGLTSDPQLQKLLFVVFLIMYSITVLGNLVMFFLIHVSTTLHTPMY
SLLKSLSFLDFCYSSTVVPQTLMNFLVQRKVISYFGCMAQMFFYAGFATSECYLIAAMAY
DRYVAVCNPLLYPTIVSPNVCASLIVGSYSAGFLNSLIHTSCIFSLNFCGAHVVTHFFCD
GPPILSLSCVDTSLCEILLFIFAGFNLLSCTLTILISYFLIFVAILRMHSTQGRFKALST
CTSHLTAVCFFFGTTLFMYLRPRSSYSLTQDRTVAVIYTVVIPMLNPLIYSLRNKDVKEA
LRRVWGWKSMR