Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5c1 Olfactory Receptor

Gene Symbol Or5c1
Organism Rat
Family 5
Subfamily c
Pseudo No
Location chr3:21363285-21364265 (+)
Aliases Olr434, Olr434

Sequence information


Nucleotide sequence

ATGAGCTCAGAGAACTTCACCTGGTCCAGAGTTACGCCTGCTGAGTTCATTCTCTTGGGG
ATCACAAATCGTTGGGACCTGCGCGTGACCCTCTTCCTGATATTCCTGCCCATCTACCTC
ATGAGCCTGCTGGGAAATGTGGGAATGGTGCTACTCATCCGTATAGATGCCAGGCTCCAC
ACACCCATGTACTTCTTCCTGGCCAACCTCTCCCTGCTGGATGCCTTCTATTCCTCTGCC
ATAGGCCCCAAGATGCTAGTGGATCTTCTACTGTCCCGTGCCACCATCCCTTATGCAGCC
TGTGCCCTCCAGATGTTTGTCTTTGCAGGGTTGGCTGATGCTGAGTGTTGCCTGTTAGCA
GTCATGGCCTATGATCGCTATGTGGCCATTGGGAACCCTCTCCTCTATACCACAGTCATG
TCACCCCGTCTATGCCTGGCCCTCCTTGGGGCATCAGGCCTGGGAGGAGCAGTGAGTGCC
TTTGTACATACAACTTTCACCTTCCGCCTGAGCTTCTGTGGCTCACTAGAAGTCAACAGC
TTCTTCTGCGATATTCCTCCACTGCTTGCCATCTCCTGCAATGACACCAGTCTAAATGAA
CTCCTCCTTTTTGCTGTCTGTGGTTTTATCCAGACAGCCACAGTGTTGGCTATTGCTGTG
TCTTATGGATTCATCGCTGGTGCTGTGATCCGCATGCAGTCAGTTGAGGGCCGTCGGAGG
GCAGCTTCCACTTGTGGCTCTCACCTCACAGCTGTAGCCATACTATATGGGACTCTTATT
TTCATGTATCTGCGTCCTAGCTCCAGCTATGCCCTGGACACGGACAAGATGGCATCAGTG
TTCTATACTCTCGTCATTCCAGCTCTCAACCCACTCATCTACAGCCTTAGAAACAAGGAA
GTCAAGGAAGCCTTCCGGCGCACTTGCCATCGATTCTGCTGCTCGGGGCGGAGCACCAGT
GACTGGCCACAGGAAGCTCCT


Conceptual translation

MSSENFTWSRVTPAEFILLGITNRWDLRVTLFLIFLPIYLMSLLGNVGMVLLIRIDARLH
TPMYFFLANLSLLDAFYSSAIGPKMLVDLLLSRATIPYAACALQMFVFAGLADAECCLLA
VMAYDRYVAIGNPLLYTTVMSPRLCLALLGASGLGGAVSAFVHTTFTFRLSFCGSLEVNS
FFCDIPPLLAISCNDTSLNELLLFAVCGFIQTATVLAIAVSYGFIAGAVIRMQSVEGRRR
AASTCGSHLTAVAILYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKE
VKEAFRRTCHRFCCSGRSTSDWPQEAP