Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5h18 Olfactory Receptor

Gene Symbol Or5h18
Organism Rat
Family 5
Subfamily h
Pseudo No
Location chr11:43521000-43521980 (+)
Aliases Olr1551, Olr1551

Sequence information


Nucleotide sequence

ATGCTCCATTATACTTACTCTATTTCATTTCAGGCAACGTCCAGTGAGCAGCACATGGAA
AGAGAGAATACAACATTGCTGACAGAGTTTGTTCTCACAGGGCTCACGGATCATCAAGGA
CTGCAGGTGCCCCTGTTCCTGCTATTCTTGGCCATATATCTCATCACTATAGTAGGGAAC
CTAGGTCTGATTGCTCTCATCTGGACTGACCCCCACCTGCATATCCCTATGTACTTTTTC
CTTGGGAGTTTGGCTTTTGTAGATGCCTGGATATCATCCACAGTGACTCCTAATATGTTG
TTTGATTTGTTATCCACAAACAAGATGATATCACTTTCTGAGTGCATGATACAATTTTTT
GCCTTTGCCTTTGGTGGAACCACAGAATGCTTTCTTTTGGGTACAATGGCCTACGATCGA
TATGTAGCCATATGCAAACCACTACTTTATCCAGTTATTATGACCAATAGACTTTGCATC
CGCCTGCTAGTTTCAGTATTTGTAGGTGGCTTTCTTCATTCCTTGTTTCATGTATTGTTC
TTATTCAGATTAACCTTCTGTAATTCTAACATAATCCACCACTTTTATTGTGACATTATA
CCACTGTATAATATTTCCTGTACAGACCCTACTCTTAACCTTCTATTAGTATTTATTTTG
TCTGGTTCAATACAGGTAGTCACCATTATGACTGTCCTGGTTTCATATACACTCGTGCTG
TTTACAATCTTAAAAATGAAGTCTCTACAAGGTATAAGGAAGGCTTTCTCCACCTGTGGA
GCTCATCTCTTATCTGTGTCCTTATACTATGGGCCTCTTCTCTTCATGTATGTGCTCCCT
GCATCTCAACAAACAGATGAACAAGGTATGATGGACTCGCTTTTTTACACAGTCATAATC
CCTGTGCTAAACCCAATTATCTACAGCCTGAGAAACAAGCAAGTCACAGATTCACTGAAA
AAAAGATTAGAGAGGCACATT


Conceptual translation

MLHYTYSISFQATSSEQHMERENTTLLTEFVLTGLTDHQGLQVPLFLLFLAIYLITIVGN
LGLIALIWTDPHLHIPMYFFLGSLAFVDAWISSTVTPNMLFDLLSTNKMISLSECMIQFF
AFAFGGTTECFLLGTMAYDRYVAICKPLLYPVIMTNRLCIRLLVSVFVGGFLHSLFHVLF
LFRLTFCNSNIIHHFYCDIIPLYNISCTDPTLNLLLVFILSGSIQVVTIMTVLVSYTLVL
FTILKMKSLQGIRKAFSTCGAHLLSVSLYYGPLLFMYVLPASQQTDEQGMMDSLFYTVII
PVLNPIIYSLRNKQVTDSLKKRLERHI