Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5h26 Olfactory Receptor

Gene Symbol Or5h26
Organism Rat
Family 5
Subfamily h
Pseudo No
Location chr11:45666328-45667254 (-)
Aliases Olr1535, Olr1535

Sequence information


Nucleotide sequence

ATGGGAATAGAGAATGCAACACTACTGACAGAATTTGTTCTCACCGGACTCAGTCATCTG
CCCCAGTGGAAAATCCCCCTGTTCCTGCTGTTCTTGGTCATCTATCTCATCACCATTGTG
GGGAACCTTGGTCTGATCACTCTCATCTGGAATGACCCTCACCTTCACATCCCCATGTAC
TTATTTCTTGGGAGTTTAGCTTTTGTGGATACCTGGTTATCCTCCACAGTGACACCAAAG
ATGCTACTAGACTTTTTCACCAAGAGTAAACTGATCTCTTTCTCTGAATGCATGATACAG
TTTTTTTCGTTTGGAATCAGTGCAACCACAGAATGTTTTCTCTTGGCAGCCATGGCCTAT
GATCGTTATGTAGCCATATGCAAACCTTTACTCTACCCAGTCATCATGACAAATAGACTC
TGTGTACGTCTTCTAACAATGTCCTTTATAGGTGGATTTATTCATGTTTTGATTCATGAA
GGCTTTTTATTCAGAATAACATTCTGTGATTCTAATGTAATACATCACTTTTATTGTGAT
ATTATGCCACTGTTAAAGATTTCCTGTAGTGACCCTTCTCTTAATTACCTGATGCTTTTT
ATTTTGTCTGGCTCCATTCAGGTTTTCAGTATTTTGACTATTCTTATCTCATATACACTT
GTTCTATTTTCAATCCTAAAGCAGAAATCTATCAAAGGCATAAAAAAATCTTTTTCTACC
TGTGGAGCCCATCTCCTCTCTGTATCTTTATACTATGGCTCCCTTCTCTTCATGTATGTG
CGTCCTGCATCTCCACAAGTAGATGATCAAGATATGATGGACTCTGTATTTTACACTGTT
ATAATTCCTGTACTTAACCCAATTATTTACAGTTTGAGAAATAAGCAAGTAAAAAATTCA
CTGGAAAAATTGCTAAAGAGAAATACT


Conceptual translation

MGIENATLLTEFVLTGLSHLPQWKIPLFLLFLVIYLITIVGNLGLITLIWNDPHLHIPMY
LFLGSLAFVDTWLSSTVTPKMLLDFFTKSKLISFSECMIQFFSFGISATTECFLLAAMAY
DRYVAICKPLLYPVIMTNRLCVRLLTMSFIGGFIHVLIHEGFLFRITFCDSNVIHHFYCD
IMPLLKISCSDPSLNYLMLFILSGSIQVFSILTILISYTLVLFSILKQKSIKGIKKSFST
CGAHLLSVSLYYGSLLFMYVRPASPQVDDQDMMDSVFYTVIIPVLNPIIYSLRNKQVKNS
LEKLLKRNT