Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5k1-ps Olfactory Receptor

Gene Symbol Or5k1-ps
Organism Rat
Family 5
Subfamily k
Pseudo Yes
Location chr11:43,932,000-43,932,900 (+)
Aliases LOC682042

Sequence information


Nucleotide sequence

ATGCTTAAAGAAAATCACACCATGAAGTGTAAGTTTACCCTCACAGGATTTACAGACCAT
CCTGAAATGAAGGCCCTTCTGTTTGCGGTATTCTTTATCATCTATCTGATTACCATGGTA
GGGAATATGGGCCTAGTGATTCTGATTTCCAGAGAACGTTCTCTTCACACCCCAATGTAC
ATCTTTCTGGGCCACCTGGCTCTCATAGATTCTTGTTGTGCTTGTGCTATTACCCCTAAG
ATGTTGGAGAACTTTTTCTCTGAGACTGGAATAATTTCTCTTTATGAGTGCATGGCACAG
TTTTATTTTCTGTGCACTGTTGAAACTGCAGACTGCTTTCTTCTGGCAGCCATGGCCTAT
GACCGCTATGTGGCCATATGCAACCCCCTGCAGTACCATACCATGATGTCCAAGAAACTC
TGCCTTCAGATGACCGTGGGAGCCTTCATAGCTGGTAACCTGCATTCCATGATTCATGTG
GGGCTATTATTTAGACTAGCATTCTGTGGGTCTAATCAAATCAACCACTTTTATTGTGAT
ATTCTTCCTTTGTACAGACTCTCCTGTGTTGACCCCTATATCAACGAGCTTGTGCTGTTT
GTCTTTTCAGGCTCTATCCAAGTCTTCACAATAGGCTGTGTGCTCGTATCTTACCTTTAC
ATTGTTTTAACAATTTTCCAGATGAAATCCAAAGAGGGAAGGGTGAAAGCCTTCTCCACC
TGTGCGTCCCATTTTCTGTCTGTTTCACTATTCTAGGGATCTCTTTTCTTCATGTACATT
AGACCAAATTTGCTAGAAGAAGGGGATAAAGATATACCGGCTGCTATTTTGTTTACAATA
GTGGTTCCCTTACTAAACCCATTTATTTATAGCCTGAGAAATAAAGAAGTAAAGAATGTC
TTGCAGAAAATTCTGCAGAAAAAAATAATCTCAAGGAATTTTAGACAAGCATCA


Conceptual translation

MLKENHTMKCKFTLTGFTDHPEMKALLFAVFFIIYLITMVGNMGLVILISRERSLHTPMY
IFLGHLALIDSCCACAITPKMLENFFSETGIISLYECMAQFYFLCTVETADCFLLAAMAY
DRYVAICNPLQYHTMMSKKLCLQMTVGAFIAGNLHSMIHVGLLFRLAFCGSNQINHFYCD
ILPLYRLSCVDPYINELVLFVFSGSIQVFTIGCVLVSYLYIVLTIFQMKSKEGRVKAFST
CASHFLSVSLF*GSLFFMYIRPNLLEEGDKDIPAAILFTIVVPLLNPFIYSLRNKEVKNV
LQKILQKKIISRNFRQAS