Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5l14 Olfactory Receptor

Gene Symbol Or5l14
Organism Rat
Family 5
Subfamily l
Pseudo No
Location chr3:76113967-76114911 (-)
Aliases Olr603-ps, Olr603-ps, LOC102555599

Sequence information


Nucleotide sequence

ATGGGGCAGATGGTTGAGGAAAACTGCAGCATGGTAGCACAGTTCATCCTCCTGGGATTT
TCAGATGTTCCTGAGTTGAGTGGTTTTCTCTCCTCAATTGTACTTCTCATTTATGGAGTC
ACTGTCCTGGCCAATCTGGGAATTACTGCACTAATACAAGTCAGCTCTCAACTTCATACC
CCCATGTACTTTTTTCTCAGCCATCTTTCCTTTGTGGATTTTTGCTACTCCTCCATCATT
GTGCCTAAAATGCTGGCTAACATCTTCAATATGGACAAAGCCATATCATTCCTGGCATGT
ATGGTCCAATTCTTCCTGTTTTGCACATGTGTGGTCACTGAAGTCTTCCTGCTAGCTGTG
ATGGCCTATGACCGCTTTGTAGCCATCTGTAACCCACTACTATATACTGTCATCATGTCC
TCAGATCTACGTATCATACTAGTGTCTGGCTGCTACTTGTGTGCATCAGTGTGTTCTCTG
GTTCATTTGTGCTTAGCCCTTGAGATCCCATCGTTTAAGTCAAATGTGATCAACCACTTC
TTCTGTGATCTGCCTCCTCTCTTGGGTCTTGCTTGCTCTGATGTCACTATTAATAAAGTG
CTGTTGTTTGTTGTGGCTACCTTCAATGAGAGTGTTAGTATTGTGGTTATCTTCACCTCC
TACTTGTTTATCCTCATCACCATCCTGAGGATGCGCTCTGTAGAGGGGAGGCGCAAAGCC
TTTTCCACCTGTGCCTCCCACCTCACAGTCATCATTGTCTTCCATGGGACAATCCTTTCC
ATTTATTGTTCTTCCACTTCAGACAACAGTGGGGATGCTGACAAAGTGGCCACAGTGTTC
TACACTGTAGTGATTCCCATGCTGAACCCTTTAATCTACAGCCTCAGAAACAAGGATGTC
AAAGATGCTCTCAGGAAAGTTGTAAATATTAAGATATGTTCCCAA


Conceptual translation

MGQMVEENCSMVAQFILLGFSDVPELSGFLSSIVLLIYGVTVLANLGITALIQVSSQLHT
PMYFFLSHLSFVDFCYSSIIVPKMLANIFNMDKAISFLACMVQFFLFCTCVVTEVFLLAV
MAYDRFVAICNPLLYTVIMSSDLRIILVSGCYLCASVCSLVHLCLALEIPSFKSNVINHF
FCDLPPLLGLACSDVTINKVLLFVVATFNESVSIVVIFTSYLFILITILRMRSVEGRRKA
FSTCASHLTVIIVFHGTILSIYCSSTSDNSGDADKVATVFYTVVIPMLNPLIYSLRNKDV
KDALRKVVNIKICSQ