Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5p80 Olfactory Receptor

Gene Symbol Or5p80
Organism Rat
Family 5
Subfamily p
Pseudo No
Location chr1:172822544-172823473 (+)
Aliases Olr273-ps, Olr273-ps

Sequence information


Nucleotide sequence

ATGGAACCTGGAAACTACACAGTGGTAACAGAGTTGATTCTTTTGGGGTTTACAGAGGAT
GCTACAGTCCGTGCCATATTATTTGTTGTGTTTCTAATAATCTACTCTGTCACCTTAATG
GGCAATATGAGCATAATCATGCTAATCAGAAGAAGTCCTCAGCTTCACATGCCCATGTAC
CTTTTCCTCAGCCATTTGGCATTTGTAGACATTGGGTACTCCTCATCAGTCACACCCATC
ATGCTGAAGGGCTTTCTCAGGAAAGAAACATTTATCCTTGTGGCTGGCTGTGTGGCTCAA
CTCTGCTCTGTAGTGACATTTGGGTCAGCTGAGTGCTTCCTGCTGGCTGCCATGTCCTAT
GACCGCTATGTAGCTATCTGCTCACCTCTGCTCTATGCCACACAGATGTCCTCCACAGTT
TGTATTCTCCTAGTGGGAGCTTCCTACCTAGGTGGATGTGTGAATGCTTGGACATTTACT
GGATGTTTATTAAATCTGTCTTTTTGTAGACCAAATAAAGTTAATCACTTTTTTTGTGAC
TATTCACCACTGTTGAAGATTTCATGTTCTCATGGATTTTCTTCTGAAGTCATTCCAGCA
ATCTCTTCAGGCTCAATCATTGTGGTAACTGTGTTTATCATCGCACTGTCTTACGTTTAC
ATCCTTGTATCAATCCTGAAGATGCGGTCCCCTGAGGGCCGCCAGAAGGCCTTCTCAACC
TGCACCTCCCACCTCACTGCTGTCACTCTGTTCTATGGAACCATCACATTCATTTATGTG
ATGCCCAAATCCAGTTACTCCACAGACCAAAACAAGGTGGTGTCTGTATTCTACACAGTG
GTAATCCCAATGTTGAACCCCATCATCTATAGCCTCAGAAACAAGGATGTTAAAGAGGCT
ATGAAAAAATTGATGGCTGACGCACACTGG


Conceptual translation

MEPGNYTVVTELILLGFTEDATVRAILFVVFLIIYSVTLMGNMSIIMLIRRSPQLHMPMY
LFLSHLAFVDIGYSSSVTPIMLKGFLRKETFILVAGCVAQLCSVVTFGSAECFLLAAMSY
DRYVAICSPLLYATQMSSTVCILLVGASYLGGCVNAWTFTGCLLNLSFCRPNKVNHFFCD
YSPLLKISCSHGFSSEVIPAISSGSIIVVTVFIIALSYVYILVSILKMRSPEGRQKAFST
CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNKDVKEA
MKKLMADAHW