Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6a2b Olfactory Receptor

Gene Symbol Or6a2b
Organism Rat
Family 6
Subfamily a
Pseudo No
Location chr1:171,059,000-171,060,000 (-)
Aliases Olr226, LOC100911376

Sequence information


Nucleotide sequence

ATGAGATACCTTGGTCTCATCTCTTGGAGAGTAGTGAACAAGACTGAAATCATGGAGCGA
AGGAACCACAGTGGGAGAGTGAGTGAATTTGTGTTGCTGGGTTTCCCAGCTCCTGCCCCA
CTGCGAGTACTACTATTTTTCCTTTCTCTTCTGGCCTATGTGTTGGTGTTGACTGAAAAC
ATGCTCATCATTATAGCAATTAGGAACCACCCAACCCTCCACAAACCCATGTATTTTTTC
TTGGCTAATATGTCATTTCTGGAGATTTGGTATGTCACTGTTACGATTCCTAAGATGCTC
GCTGGCTTCATTGGTTCCAAGGAGAACCATGGACAGCTGATCTCCTTTGAGGCATGCATG
ACACAACTCTACTTTTTCCTGGGCTTGGGTTGCACAGAGTGTGTCCTTCTTGCTGTGATG
GCCTATGACCGCTATGTGGCTATCTGTCATCCACTCCACTACCCCGTCATTGTCAGTAGC
CGGCTATGTGTGCAGATGGCAGCTGGATCCTGGGCTGGAGGTTTTGGTATCTCCATGGTT
AAAGTTTTCCTTATTTCTCGCCTGTCTTACTGTGGCCCCAACACCATCAACCACTTTTTC
TGTGATGTGTCTCCATTGCTCAACCTGTCATGCACTGACATGTCCACAGCAGAGCTTACA
GACTTTGTCCTGGCCATTTTTATTCTGCTGGGACCGCTCTCTGTCACTGGGGCATCCTAC
ATGGCCATCACAGGTGCTGTGATGCGCATCCCCTCAGCTGCTGGCCGCCATAAAGCCTTT
TCAACCTGTGCCTCCCACCTCACTGTTGTGATCATCTTCTATGCAGCCAGTATTTTCATC
TATGCCAGGCCTAAGGCACTCTCAGCTTTTGACACCAACAAGCTGGTCTCTGTACTCTAC
GCTGTCATTGTACCGTTGTTCAATCCCATCATCTACTGCTTGCGCAACCAAGATGTCAAA
AGAGCGCTACGTCGCACGCTGCACCTGGCCCAGGACCAGGAGGCCAATACCAACAAAGGC
AGCAAAAATGGT


Conceptual translation

MRYLGLISWRVVNKTEIMERRNHSGRVSEFVLLGFPAPAPLRVLLFFLSLLAYVLVLTEN
MLIIIAIRNHPTLHKPMYFFLANMSFLEIWYVTVTIPKMLAGFIGSKENHGQLISFEACM
TQLYFFLGLGCTECVLLAVMAYDRYVAICHPLHYPVIVSSRLCVQMAAGSWAGGFGISMV
KVFLISRLSYCGPNTINHFFCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTGASY
MAITGAVMRIPSAAGRHKAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLY
AVIVPLFNPIIYCLRNQDVKRALRRTLHLAQDQEANTNKGSKNG