Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6c2 Olfactory Receptor

Gene Symbol Or6c2
Organism Rat
Family 6
Subfamily c
Pseudo No
Location chr7:5105773-5106708 (-)
Aliases Olr892, Olr892

Sequence information


Nucleotide sequence

ATGAGAAACCAGTCAACAATAACAACCTTCATTCTTTTGGGACTAACAGATGACCCACAA
CTTCAAGTTCTGCTTTTTATCTTCCTATTTCTGACATACATACTTAGTGTAACAGGAAAC
CTGGTTATCATCATCCTTACCTTGGTGGATCCCCATCTTAAAACACCCATGTACTTTTTT
CTTAGAAATTTTTCATTTCTAGAAGTTTCCTTTACCACAGTCTGTATTCCTAGATTTCTA
TACAGTATCTCAAGTGGAGATAATACCATTACCTATAACGCTTGTGCAAGTCAAATATTC
TTTGTTATTCTCTTTGGAGCAACTGAATTTTTTCTCTTGGCAGCTATGTCCTATGATCGC
TATGTGGCCATCTGTAAACCCCTTCATTATATGGCCATTATGAATCCCAGGGTGTGTATC
TTATTAGTTATCACATGTTGGGTATCTGGCTTAATGATTATTATTCCACCCCTTGGCATG
GGCCTCCAACTTGACTTCTGTGATTCCAATGCCATTGATCATTTCAGCTGTGATGCAGGT
CCCCTTCTAAAGATCTCCTGCTCAGACACATGGGTAATAGAACAAATGGTTATACTTGTG
GCTGTCTTTGCACTCATTATTACCCTAATCTGTGTGATCCTATCCTATACATACATCATC
AGAACAATTCTGAGATTCCCTTCCGTACAGCAAAGAAAAAAGGCCTTTTCCACCTGCTCA
TCCCACATGATTGTGGTTTCCATCACCTATGGAAGCTGCATCTTCATCTACATCAAGCCA
TCAGCCAAGGATGAAGTGGCCATAAATAAAGGAGTTTCAGTCCTCACTACTTCTGTTGCA
CCTCTGTTGAACCCCTTCATTTATACCTTAAGGAACAAGCAAGTGAAACAGGCATTCAGT
GACTCTGTAAAGAGAATTTCACTTATATCAAAGAGC


Conceptual translation

MRNQSTITTFILLGLTDDPQLQVLLFIFLFLTYILSVTGNLVIIILTLVDPHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYSISSGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR
YVAICKPLHYMAIMNPRVCILLVITCWVSGLMIIIPPLGMGLQLDFCDSNAIDHFSCDAG
PLLKISCSDTWVIEQMVILVAVFALIITLICVILSYTYIIRTILRFPSVQQRKKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS
DSVKRISLISKS