Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6c2c Olfactory Receptor

Gene Symbol Or6c2c
Organism Rat
Family 6
Subfamily c
Pseudo No
Location chr7:4236046-4236972 (-)
Aliases Olr983-ps, Olr983-ps

Sequence information


Nucleotide sequence

ATGAGAAACCACTCAACAATAACAACCTTCATTCTTTTGGGACTAACAGATGACCCACAA
CTTCAAGTTCTGCTTTTTATCTTCCTATTTCTGACATGCATACTTAGTGTAACAGGAAAC
CTGATTATCATCGTCCTCACCTTGGTGGATCCCCATCTTAAAACACCCATGTACTTTTTT
CTCAGAAATTTTTCATTTCTAGAAGTTTCCTTTACCACAGTCTGTATTCCTAGATTTCTA
TACAGTATCTCAAGTGGAGATAATACCATTACCTATAATGCTTGTGCAAGTCAAATATTC
TTTGTTATTCTCTTTGGAGCAACTGAATTTTTTCTCTTGGCAGCTATGTCCTATGATTGC
TATGTGGCCATCTGTAAACCCCTTCATTATATGGCCATTATGAATCCCAGGGTGTGTATC
TTATTAGTTATCACATGTTGGGTATCTGGCTTAATGATTATTATTCCACCCCTTGGCATG
GGCCTCCAACTTGACTTCTGTAATTCCAATGCCATTGATCATTTCAGCTGTGATGCAGGT
CCCCTTCTAAAGATCTCCTGCTCAGACACATGGGTAATAGAACAAATGGTTATACTTGTG
GCTGTCTTTGCACTCATTATTACCCTAATCTGTGTGATCCTATCCTATACATACATCATC
AGAACAATTCTGAGATTCCCTTCCATACAGCAAAGAAAAAGGGCCTTTTCCACCTGCTCA
TCCCACATGATTGTGGTTTCCATCACTTATGGAAGCTGCATCTTCATCTACATCAAGCCA
TCAGCCAAGGATGAAGTGGCCATAAATAAAGGAGTTTCAGTCCTCACAACTTCTGTTGCA
CCTCTATTGAACCTCTTCATTTATACCTTAAGGATTGAACCTCTTCATTTATACCTTAAG
GAACAAGCAAGTGAAACAGGCATTCAG


Conceptual translation

MRNHSTITTFILLGLTDDPQLQVLLFIFLFLTCILSVTGNLIIIVLTLVDPHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYSISSGDNTITYNACASQIFFVILFGATEFFLLAAMSYDC
YVAICKPLHYMAIMNPRVCILLVITCWVSGLMIIIPPLGMGLQLDFCNSNAIDHFSCDAG
PLLKISCSDTWVIEQMVILVAVFALIITLICVILSYTYIIRTILRFPSIQQRKRAFSTCS
SHMIVVSITYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNLFIYTLRIEPLHLYLK
EQASETGIQ