Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6c76-ps Olfactory Receptor

Gene Symbol Or6c76-ps
Organism Rat
Family 6
Subfamily c
Pseudo Yes
Location chr7:8,882,220-8,882,990 (-)
Aliases Olr935-ps, Olr1053-ps

Sequence information


Nucleotide sequence

ATGTATTTCTTCCTCAGGAATTTCTCCTTCTTAGAAATTTCATTTACTTCTGTCTGTAAC
CATAGGTTTTTGGTCAGCATCCTAACTAAGGACAAGTACATCTCCTATAATGCTTGTGCT
GCCCAACTATTTTTCTTTATCTTCCTTGGCTCAACAGAGTTTTTCCTTCTGGCATCCATG
TCCTATGATCACTATGTGGCAATTTGCAAGCCCCTACACTACACAACCATCATCAGTAAC
AAGATCTGCCACCAGCTCATCATCAGCTCTTGGCTGGCTGGTTTCTTGGTAATGTTTCCT
CCACTGGCCATGGGCTTAGAGTTAGATTTCTGTGACTCCAACATTATTGACCACTTCACA
TGTGACTCTGCCCCTTTGCTGCAAATATCCTGCACAGACACAAGCACTTTGGAGCTTATG
AGCTTTATATTAGCTTTGGTCACACTTATGAACACACTGATGCTGATAATTCTCTCTTAC
ACCTGTATTCTCAGAACTATTCTGAAATTTCCCTTAGTCAAACAAAGGGAAAAGGCCTTT
GCAACCTGCTTCTCACACATGATTGTTGTCTCCATATCCTATGGAAGCTGCATCTCCATG
TATGTGAAAACATCTGCCAAGGCTGGAGTTGCTTTGACAAAGGGGGTGGCTATGCTCAAC
ACGTCTGTTGCTCCCATGCTGAATTCTTTTATCTACACTTTAAGGAACAAACAGGTGAAA
CAAGCATTTAAGGATCTTGTGAGAAGAAAGCTTCTTCAAAATGCTGATCTTATT


Conceptual translation

MRNRTSVTYFILLGLTDDPELQVVIFFLLFLTYVLSVTGNLTIIKLTLLDSHLKT/MYF
FLRNFSFLEISFTSVCNHRFLVSILTKDKYISYNACAAQLFFFIFLGSTEFFLLASMSYD
HYVAICKPLHYTTIISNKICHQLIISSWLAGFLVMFPPLAMGLELDFCDSNIIDHFTCDS
APLLQISCTDTSTLELMSFILALVTLMNTLMLIILSYTCILRTILKFPLVKQREKAFATC
FSHMIVVSISYGSCISMYVKTSAKAGVALTKGVAMLNTSVAPMLNSFIYTLRNKQVKQAF
KDLVRRKLLQNADLI