Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6c76b Olfactory Receptor

Gene Symbol Or6c76b
Organism Rat
Family 6
Subfamily c
Pseudo No
Location chr7:16,431,800-16,432,700 (-)
Aliases Olr932

Sequence information


Conceptual translation

MFSVLNLSIRFAIDKPSEMRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYMLSITGNLT
IITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFF
IFLGSTEFFLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVIFPPLAMGL
ELDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSYTCILRT
ILKFPSAKQREKAFATCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPM
LNPFIYTLRNQQVKQAFKDLVRRKLASKC