Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6f1b Olfactory Receptor

Gene Symbol Or6f1b
Organism Rat
Family 6
Subfamily f
Pseudo No
Location chr1:149786385-149787308 (-)
Aliases Olr13, Olr13

Sequence information


Nucleotide sequence

ATGATCACAGAGAATGGGACTCTATCCCAAGGCTTCCTTCTGTTAGGCTTTCCTGGATCT
CAGGTCCTCCAAACTTCTCTTTTTCTCTTTTTTCTGGTGATGTACCTCCTCACCATTGGA
GGTAATGTGGCAATCTTGCTATTGGTCAGTACTTCCCATCAGTTACAGACCCCTATGTAT
TTCTTTCTGAGCAATCTGTCATTCTTGGAGATCTGGTACACCACAGCTGCAGTCCCTAAA
GCTCTGGCCATTCTGGTGGGGAGGAGCCAGACCATATCATTTTCAGGTTGCCTTTTGCAG
ATGTACTTGGTTTTCTCTTTAGGTTGCACAGAATACTTTCTCTTGGCAGCCATGGCTTAT
GACCGCTACCTTGCCATCTGTTTTCCTCTACATTACCAGGTTATCATGAACAGCCTGCTC
TCAGCACAGCTGGCTCTTTGCTCCTGGATTTGTGGTTTCCTGGCCATTTCTGTGCCGGCA
GCCCTTATCAGCACCTTGTCCTTCTGTGGCACCCATTCCATCAATCATTTCTTCTGTGAC
ATTGCACCCTGGATTGCCCTGGCCTGTACCAGTACACAAGGAGTGGAGACAGTGGCTTTT
GTGATTGCTTTTGTGGTTATCCTGAGTTCCTGTCTCATTACTCTGATCTCTTATGCCTAC
ATCATCAGAACCATCCTGAGGATCCCCTCAACCAGTGGCCGCAGAAAAGCTTTCTCCACC
TGTTCCTCCCACCTCACTGTGGTACTCATCTGGTATGGGTCTACAATTTTCCTCCATGTT
CGAACATCTATCAAAGATGATTTGCAACTGACTAAAGCTGTTCATGTCCTCAATACAGTG
GTGACTCCAGCTCTAAATCCCTTCATTTATACCCTTCGTAACAAAGAGGTCAGAGAAATT
CTGGAGAAGAAATGGAAGAGAATG


Conceptual translation

MITENGTLSQGFLLLGFPGSQVLQTSLFLFFLVMYLLTIGGNVAILLLVSTSHQLQTPMY
FFLSNLSFLEIWYTTAAVPKALAILVGRSQTISFSGCLLQMYLVFSLGCTEYFLLAAMAY
DRYLAICFPLHYQVIMNSLLSAQLALCSWICGFLAISVPAALISTLSFCGTHSINHFFCD
IAPWIALACTSTQGVETVAFVIAFVVILSSCLITLISYAYIIRTILRIPSTSGRRKAFST
CSSHLTVVLIWYGSTIFLHVRTSIKDDLQLTKAVHVLNTVVTPALNPFIYTLRNKEVREI
LEKKWKRM