Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6k3-ps Olfactory Receptor

Gene Symbol Or6k3-ps
Organism Rat
Family 6
Subfamily k
Pseudo Yes
Location chr13:92232864-92233613 (+)
Aliases Olr1594-ps, Olr1594-ps

Sequence information


Nucleotide sequence

TTTTCCTTTTTGGAGATCTGGTATACCACAGCTACCATTCCCAAGATGCTGTCCAATCTC
ATCGATGAAAAGAAGTCCATCACCATCACTGGCTGCCTCTTACAAATGTATTTCTTTCAT
TCATTGGGGAATTCAGAGGGGATTTTGCTCATCACCATGGCTGTTGACAGATACATTGCC
ATCTGTAACCCTCTTTGCTACCAGATGATCATGACACCCAGGCTCTGTGTTCAGCTTTCT
GCAGCCTCTTGCACCTTTGGTTTTCTCATCTTGCTTCCTGAGATTGTGATGATTTCCACT
CTGCCTTTCTGTGGACCCAACCAGATCCATCAGATCTTCTGTGACTTGGTCCCTGTGCTG
AGCTTAGCCTGCACAGACACTTCTATGATTGTCATTGAGGACGTGATCCATGCAGTAGCC
ATTATCATCACTGTTCTTATCATTGCTCTGTCCTATGTAAGAATTGTCATCGTGATCCTG
AGAATTCCTTCTGCTGAGGGTAGGAGAAAGGCCTTTTCTACCTGTGCTGGTCACCTCATG
GTCTTCCTGATATTCTTTGGTAGCGTGTCACTCATGTATTTGCGTTTCAATGTCACTTAT
CCCCCAGTTTTAGAGACTGCAATTGCACTGATGTTTACTGTACTTGCCCCCTTCTTCAAT
CCCATCATTTATAGTCCTAGAAACAAGAACATGAAGAATGCAATTAAAAGACTCTTCTGC
CTTCACAAAGTTTTGAACACATCTGAAAGT


Conceptual translation

MENGSLSAVTEFIFTTFPRLQYGSLLYFFPLLFIYAFIVIGNLLIFFAVRLDSHLHNPMY
NFISIF\FLEIWYTTATIPKMLSNLIDEKKSITITGCLLQMYFFHSLGNSEGILLITMA
VDRYIAICNPLCYQMIMTPRLCVQLSAASCTFGFLILLPEIVMISTLPFCGPNQIHQIFC
DLVPVLSLACTDTSMIVIEDVIHAVAIIITVLIIALSYVRIVIVILRIPSAEGRRKAFST
CAGHLMVFLIFFGSVSLMYLRFNVTYPPVLETAIALMFTVLAPFFNPIIYSPRNKNMKNA
IKRLFCLHKVLNTSES