Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6k4 Olfactory Receptor

Gene Symbol Or6k4
Organism Rat
Family 6
Subfamily k
Pseudo No
Location chr13:92,224,900-92,225,900 (+)
Aliases Olr1593

Sequence information


Nucleotide sequence

ATGAAGACAAACTTGACCCAGAGTATAATGAGAATTAACAGAACCACTTCAGTGACTGAA
TTCCTCTTCTCCGGGCTTCCCGAGTTTGAAGATGGCCGTTTCCTCTTCTTCATTCCTTTG
TTCTTCATTTACGTATTCATTGTTATTGGGAATCTCATTGTGTTTTTTGCAGTCAGGATG
GATACCCGTCTTCACAACCCTATGTACAATTTCATCAGCATTTTCTCATTTCTGGAGATC
TGGTATACCACTGCAACTATTCCCAAAATGCTCTCTAACCTCATCAGTAAGCGGAGGACC
ATCTCTTTGATTGGCTGCCTGCTACAGATGTACTTCTTCCATTCGCTTGGAAATTCAGAG
GGTATTTTGCTGACCACAATGGCTATTGACAGATACATTGCTATCTGTAACCCTCTCCGG
TACCCAACTATCATGACTCCCCGGCTCTGTGCTCAGCTCTCTGCGGGCTCCTGTATCTTT
GGCTTTCTCGTGTTGCTTCCAGAGATTGCATGGATTTCCACACTGCCCTTCTGTGGCCCC
AACCAAATTCATCAGATCTTCTGTGACTTTGAACCTGTGTTGCGTTTAGCCTGTACGGAC
ACCTCCATGATTCTGGTTGAGGATGTGGTGCATGCCGTGGCCATCATCTTTTCTGTCTTG
GTTATTGCCTTCTCTTACATCAGAATCATCACTGTGATCCTGAGGATTCCCTCTGGTGAA
GGGCGTCGGAAGGCTTTCTCTACTTGTGCTGCCCATCTCGGTGTCTTCCTGATGTTCTAT
GGCAGTGTCTCTCTCATGTATCTGCGTTTCTCAGCTACTTTCCCACCAGTGTTAGACACA
GCGATTGCACTAATGTTTGCAGTTCTTGCACCCTTTTTCAACCCTATCATCTATAGTCTG
AGAAATAAGGACATGAAGACCGCAATTAAGAAGCTTCTCTCCTCTCCGACGATGCTGCCT
ACCTCTGCAAGC


Conceptual translation

MKTNLTQSIMRINRTTSVTEFLFSGLPEFEDGRFLFFIPLFFIYVFIVIGNLIVFFAVRM
DTRLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISKRRTISLIGCLLQMYFFHSLGNSE
GILLTTMAIDRYIAICNPLRYPTIMTPRLCAQLSAGSCIFGFLVLLPEIAWISTLPFCGP
NQIHQIFCDFEPVLRLACTDTSMILVEDVVHAVAIIFSVLVIAFSYIRIITVILRIPSGE
GRRKAFSTCAAHLGVFLMFYGSVSLMYLRFSATFPPVLDTAIALMFAVLAPFFNPIIYSL
RNKDMKTAIKKLLSSPTMLPTSAS