Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6k6 Olfactory Receptor

Gene Symbol Or6k6
Organism Rat
Family 6
Subfamily k
Pseudo No
Location chr13:92,209,100-92,210,100 (-)
Aliases Olr1592

Sequence information


Nucleotide sequence

ATGACCCAATTGGTTGCCAGCCAGAACCAAACCATGGTAATTGAGTTCCTCTTCTCTGTG
TTCCCACCTCTGCATGAAGGTGGCCTGTTATTTTTTATTCTATTAATTCTTGTCTATGCA
TTCATCATCTCAGGGAACCTAGTGATCTTTGTTGCTGTCCAGCTGGACTTGGCTCTGCAC
ACACCCATGTATTTCTTCATCAGCGTGCTGTCGTTCCTGGAGATCTGGTATACCACAACT
ACCATTCCCAAGATGCTCTCCAGTCTAGTCAGTGAGAAGAAGACCATCTCCTTAGGTGGC
TGCCTCATGCAGATGTACTTTTTCCACTCACTGGGTATCACAGAAGGCTGTGTCCTGACA
GCGATGTCCATTGACAGGTACATAGCTATCTGCTATCCTCTCCGTTACCCAACCATCATG
ACTTCCAAACTTTGTATCCAACTGACAGCTGGCTCCTGCTTCTGTGGCTTCCTTCTGGTA
CTCCCTGAGATTGCATGGATTGCAACCTTGCCTTTCTGTGGCTCCAACAAGATCCATCAG
ATCTTCTGTGATTTTACCCCTGTGCTCAGGTTGGCCTGTACGGATACATCGTTGGTGGTT
ATTGTGGACGCTATCCATGCAGTAGAGATCCTGGCCTCCTTCCTTGTGATTGCCTTGTCA
TATATCCGGATCATCATGGTAATTTTAGGGATGCCCTCAGCAGAAGGGAGGCACAAGGCT
TTCTCCACTTGTGCAGCCCACCTTGCTGTTTTCTTGCTGTTTTTTGGCAGTGTGGCTGTC
ATGTATTTGAGATTCTCGGCCACCTATTCAGTCTTCTGGGACACAGTAATTGCTGTCACT
TTCGTTATCCTTGCTCCATTTCTCAATCCCATTATTTACAGTCTAAGAAACAAGGAAATG
AAAGATGCAATTGGGAGGCTTTTTCATCGGAAGCGAGATGCTCGGGCTCAGAAA


Conceptual translation

MTQLVASQNQTMVIEFLFSVFPPLHEGGLLFFILLILVYAFIISGNLVIFVAVQLDLALH
TPMYFFISVLSFLEIWYTTTTIPKMLSSLVSEKKTISLGGCLMQMYFFHSLGITEGCVLT
AMSIDRYIAICYPLRYPTIMTSKLCIQLTAGSCFCGFLLVLPEIAWIATLPFCGSNKIHQ
IFCDFTPVLRLACTDTSLVVIVDAIHAVEILASFLVIALSYIRIIMVILGMPSAEGRHKA
FSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTVIAVTFVILAPFLNPIIYSLRNKEM
KDAIGRLFHRKRDARAQK