Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or6s1 Olfactory Receptor

Gene Symbol Or6s1
Organism Rat
Family 6
Subfamily s
Pseudo No
Location chr15:27,996,800-27,997,800 (-)
Aliases Olr1637

Sequence information


Nucleotide sequence

ATGGTTCCCAGCGGGAACCAGAGTGATGGCACTACGGAGTTTGTCCTGGCGGGCTTCCCG
AATCTCAACGGCACAGGAGTGGAAGTGTTCTCCGTGTTCCTTTTCATCTACCTGTTGACT
CTAACGGGCAACATGTTGATTGTGGGGGTGGTGGGAGCTGATCACCGCCTGCAGACGCCC
ATGTATTTCTTCCTGGGTAACTTGTCCTGCCTAGAGATTCTGATCACTTCCGTCATCATC
CCGAAGATGTTGAGCAATTTCCTCTCGAGGCGACACACCATTTCCTTTGCTGCCTGTATT
ACTCAGTTTTACTTTTACTTCTTCCTGGGGGCCTCTGAGTTCCTACTGTTGGCCGTCATG
TCTGTGGATCGCTACCTGGCCGTCTGCCGACCTCTGCATTACCCCTTGCTCATGAATGGA
GCCGTGTGTTTTCGGGTTGCCTGGGCCTGCTGGATGGGGGGACTCCTCCCCGTGCTCGGC
CCCACAGTGGCCGTGGCCCTGCTTCCTTTCTGCAAACAGGGTGCCGTGGTTCGGCATTTC
TTCTGTGACAGTGGACCCTTGCTTCACCTGGCTTGTACCAACACCACGAGACTGGAGGAG
GCTGACTTCGTCCTGGCCTTTCTTGTCATTGTCTCCTCACTCACCGTTACTGCTGCGTCT
TATGGCTTCATAGTCCTGGCTGTCCTGCGCATCCCCTCAGCTTCGGGTCGGCAGAAGGCT
TTCTCCACCTGTACCTCCCACTTGATGGTGGTGACCCTCTTCTACGGGAGTGCCATTTTC
CTCTACGTGAGGCCATCCCAGAGTGGCTCTGTGGATACGAACTGGTCAGTGACCGTGATA
ACAACATTTGTGACCCCTCTGCTGAACCCATTTATCTATGCTTTGCGCAACGATCAAGTC
AAGGAAGCTTTGAAAGAGATGTTCAGAAAGGTAGCCGCAAAGCTTTTTGAACAGACTTTA
CTTGGGGATAGTTTGAGAAAGAAGACAGTGAGT


Conceptual translation

MVPSGNQSDGTTEFVLAGFPNLNGTGVEVFSVFLFIYLLTLTGNMLIVGVVGADHRLQTP
MYFFLGNLSCLEILITSVIIPKMLSNFLSRRHTISFAACITQFYFYFFLGASEFLLLAVM
SVDRYLAVCRPLHYPLLMNGAVCFRVAWACWMGGLLPVLGPTVAVALLPFCKQGAVVRHF
FCDSGPLLHLACTNTTRLEEADFVLAFLVIVSSLTVTAASYGFIVLAVLRIPSASGRQKA
FSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVDTNWSVTVITTFVTPLLNPFIYALRNDQV
KEALKEMFRKVAAKLFEQTLLGDSLRKKTVS