Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or7e177 Olfactory Receptor

Gene Symbol Or7e177
Organism Rat
Family 7
Subfamily e
Pseudo No
Location chr8:20993734-20994618 (-)
Aliases Olfr873, Olfr873

Sequence information


Nucleotide sequence

ATGAGAGTCTCTGATGATCCAGGACTGCAGCCCATCCTCTTCTGTTTATTTATGTTTGTG
TACCTGGTTACAGTGCTTGGTAACCTGATCATCATCCTGGCTGTCAACTCTGACTCCAAC
CTCCACACTCCCATGTACTTCTTCCTCTGCAATCTGTCCTTGGCTGACATCTGTTTTATC
TCTACCACAGTCCCAAAGATGATTGTGAACATCCAGACTCACAGAAAAGAGATAATCTAT
GTGGGCTGCCTTACACAGATGTCATTTTTGATCCTTTTTGGATATATGGATTGCTTGCTT
CTGGCTGTGATGGCCTATGATAGATTTGTGGCTGTCTGTCACCCACTGCATTATTCACTC
ATCATGAATCCTCGCCTCTGTGGCTCTTTAGTTTTCCTGTCTCTCTTGGTTAGTCTCGTG
GATTCTCAGGCACACAATCTCATTGCCTTACAAATCATCTACTTCAAGGATGTAGAAATT
TCCAATTTCTTTTGTGACCCTGCACAACTCCTTAATCTTGCCTGTTTTAACACATTCATT
AATGACATAGTCATGTATTTTGTTGGTGCCTTATCTGGTTTGCTTCCTATATCTGGAATT
TTCTTCTCTTACTATAAAATTGTTTTTTCCATTCTGAAAATATCATCATCAGGTGGGAGG
TATAAAGCCTTCTCTACTTGTGGGTCTCACCTGTCAGTTGTTTGTTTATTTTATGGAACA
GCCTTGGGAGTATATCTTGGTTCAGCTGTATCACGTTCTCCCAGAAGTACTGCAGTGGCC
TCACTGATGTACACTGTGGTCACTCCTATGCTAAATCCTTTCATCTACAGCCTGAGGAAC
AAGGATATTAAAAGAGCAGTGAAGAGATTCCACAGAAAAATGCTG


Conceptual translation

MRVSDDPGLQPILFCLFMFVYLVTVLGNLIIILAVNSDSNLHTPMYFFLCNLSLADICFI
STTVPKMIVNIQTHRKEIIYVGCLTQMSFLILFGYMDCLLLAVMAYDRFVAVCHPLHYSL
IMNPRLCGSLVFLSLLVSLVDSQAHNLIALQIIYFKDVEISNFFCDPAQLLNLACFNTFI
NDIVMYFVGALSGLLPISGIFFSYYKIVFSILKISSSGGRYKAFSTCGSHLSVVCLFYGT
ALGVYLGSAVSRSPRSTAVASLMYTVVTPMLNPFIYSLRNKDIKRAVKRFHRKML