Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or7g12 Olfactory Receptor

Gene Symbol Or7g12
Organism Rat
Family 7
Subfamily g
Pseudo No
Location chr8:18845552-18846514 (+)
Aliases Olr1125, Olr1125

Sequence information


Nucleotide sequence

ATGTTCTTTCTTAGCATCATCAACATCATGAAGAGAGGAAACTTTTCAGACCCTACAGAA
TTCCATCTTATGGGACTATCAGATAACCAAGAACTACAGTCTGTCCTATTTGGAGCCTTT
CTATCCATATATCTGATCACAGTGTTTGGGAACATTCTCATAATACTGGCTACTGCTTTT
GATTCCAACCTCCATACACCTATGTACTTCTTCATTTCCAACTTGTCTTTCATTGACATC
TGTTTTACCACCACCACCATACCAAAAATGTTGGTGAATATTCAGACTCAGATCAGCTCC
ATTAGTTATGTAGGCTGCCTCACTCAAATCTGCTTTGTTTTAGCTTTTGCAGGATTGGAA
AATGGAATTCTGGTAATGATGGCCTATGATAGGTTTGTGGCTATCTGTCATCCACTGAGG
TACACTGTCATTATGAATCCCAAATTCTGTGGTGTGATGCTTTTGTTGTCCTTCTTGATA
AGCATTCTAGATGCTTTGCTCCACACTTTGATGGCACTGCGCCTGTCATTCTGCACAAAG
GTGGAAATTCCTCACTTTTTTTGTGAACTAGCTCATATTCTCAAGCTTGCATGTTCCAAT
ATTCTAATCAATAATATTCTGGTGTATTTGGTGACAAGTCTGTTGGGTGTTCTTCCACTG
TCTGGTATAATTTATTCTTATACTAGAATTATTTCCTCTGTTTTGAAAATTCCATCAGCT
GCAGGAAAATATAAAGTTTTCTCCACATGTGCTTCACACTTAGTAGTGGTTATCTTGTTC
TATGGTACAGGTTTTGGTGTTTATCTGAGTTCTGCTGGCACTCATAGCACTAGAAAGAGT
GCAATAGCCTCTGTGATGTACACTGTGGTCACTCCCATGATGAATCCTTTTATATATAGC
TTGAGAAATAAGGACATGGTTGAGGCTTTCAAAAAACTCATCTCTCGAATAACAGCTCCC
CTT


Conceptual translation

MFFLSIINIMKRGNFSDPTEFHLMGLSDNQELQSVLFGAFLSIYLITVFGNILIILATAF
DSNLHTPMYFFISNLSFIDICFTTTTIPKMLVNIQTQISSISYVGCLTQICFVLAFAGLE
NGILVMMAYDRFVAICHPLRYTVIMNPKFCGVMLLLSFLISILDALLHTLMALRLSFCTK
VEIPHFFCELAHILKLACSNILINNILVYLVTSLLGVLPLSGIIYSYTRIISSVLKIPSA
AGKYKVFSTCASHLVVVILFYGTGFGVYLSSAGTHSTRKSAIASVMYTVVTPMMNPFIYS
LRNKDMVEAFKKLISRITAPL