Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or7g34 Olfactory Receptor

Gene Symbol Or7g34
Organism Rat
Family 7
Subfamily g
Pseudo No
Location chr8:19585843-19586811 (-)
Aliases Olr1149, Olr1149

Sequence information


Nucleotide sequence

ATGTTTCACCCTCTCTATCAGATTTATGAACAACATGAAAAGAGAAACCAAACAGCTTTT
CCAGGATTCTTTCTTCTGGGACTGACAGAAGACCCCAAATTACAGCCTGTATTGGTCAGT
TTGTTCTTTTCTATATATCTGGTTACCCTTCTGGGAAACTTGCTTATAATTGTGATTTCT
ATCTCAGACTCCCATCTTCATACCCCTATGTATATATTTCTTTCTAACTTGTCCTTAAAT
GACATCTGTTTAAGCACAAGCACGATCCCCAAGATGCTGGTGAACATACAAGAAAATATT
CAAAGCATCACATACAAAGGCTGCCTCACTCAAATGAGCTTTGTCTTAATTTTTAGTGGC
ATGGAAAACTGTCTCCTTGCAGTAATGGCTTATGACCGCTATATGGCTATTTGTCACCCC
CTGAGGTACACAGTTATCATGGAACCCTGTTTCTGTGTCCTGCTGATTCTATTGTCCCTG
CTAATTAGTCTTGTGGATTCTTTAATGCACAGCCTAATGGTGCTAAGACTGTCATTCTGC
AGACACCTGGAAATACCAAACTTCTTCTGTGAACTTCCCAAGATGCTCAAGTTGGCCTGT
TCTGATACCCTCATTGATAACATCCTTATTTATATTTCATCCTGCATATTTGCTGGAATT
CCTCTCTCTGGAATAGTTTTCTCTTATATTCATATCATGTCCTCTATTTTTAGAATGCCA
TCATCAGAAGGAAAGCACAAAGCCTTTACCACTTGTGGGTCTCACCTGTCAGTTGTTTCC
TTGTTCTATGGGACAGGTTTTGGGGTATATATTACATCTATTATTATGGATTCATCCAGG
AAAACTGCAGTGGCTTCAGTGATGTATTCTGTGGTACCTCAGATGCTGAATCCCTTTATT
TATAGTCTGAGGAACAGGGAAATGAAGGATGCTATGAGAAAATTCTTCAAGAAAATGGCT
TATTTTCTA


Conceptual translation

MFHPLYQIYEQHEKRNQTAFPGFFLLGLTEDPKLQPVLVSLFFSIYLVTLLGNLLIIVIS
ISDSHLHTPMYIFLSNLSLNDICLSTSTIPKMLVNIQENIQSITYKGCLTQMSFVLIFSG
MENCLLAVMAYDRYMAICHPLRYTVIMEPCFCVLLILLSLLISLVDSLMHSLMVLRLSFC
RHLEIPNFFCELPKMLKLACSDTLIDNILIYISSCIFAGIPLSGIVFSYIHIMSSIFRMP
SSEGKHKAFTTCGSHLSVVSLFYGTGFGVYITSIIMDSSRKTAVASVMYSVVPQMLNPFI
YSLRNREMKDAMRKFFKKMAYFL