Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8b3 Olfactory Receptor

Gene Symbol Or8b3
Organism Rat
Family 8
Subfamily b
Pseudo No
Location chr4:1470641-1471654 (+)
Aliases Olr1235, Olr1235

Sequence information


Nucleotide sequence

ATGTTAAAATTTTGGAACAGAGCTGGTTCATCCATTAATAAAAGTTTCTTCTCTCCTAGA
TTTTCAAAGGTAAGCATGCTGGCTGGAAATGGTTCCTTTGTGACTGAGTTTGTCCTTGCT
GGCTTAACAGATTGTCCAGAGCTCCAGCTGCCTCTCTTTTTCCTGTTTCTAATAATCTAC
ATTATCACAGTGGCCGGAAACATTGGTTTGATTATCCTGATTGGCCTCAATCCTCATCTG
CACACCCCGATGTACTATTTCCTTTTCAACCTCTCCTTCATTGATCTCAGCTACTCTTCT
GTCTTCAGTCCCAAAATGCTGATGAACTTTGTCTCTGAGAAGAACTCCATCTCCTTTGAG
GGGTGCATGACTCAGCTGTTTCTCTTTCTCTTTTTTGTCATCTCTGAATGCTACATGTTG
ACCTCAATGGCCTATGATCGCTATGTGGCCATTTGTAATCCATTGCTATATAAGGTCACC
ATGTCCCCTCAGGTCTGTTCTATTCTATCTTTTGCTGCTTATGGGATGGGGTTTGCTGGA
GCCTCTGTCCACACAGGCTGCATGCTCAGACTGACTTTCTGTAATGCCAATCTCATCAAC
CATTACTTGTGTGACATTCTCCCTCTCCTCCAACTTTCTTGTACCAGCACTTATGTCAAT
GAGGTGGTTGTTCTTGTAGTTGTGGGTATTAACATCACAGTCCCCAGCTGTACGATCCTC
ATTTCCTATGTTTTCATCCTCGCCAACATTCTAAACATCAAATCCACACAAGGAAGGTCA
AAAGCCTTCAGCACCTGTAGCTCTCACATCATGGCTATTTCTCTTTTCTTTGGATCAGCT
GCATTCATGTATCTTAGATATTCTTCTGGATCTATGGAACAAGGAAAAATATCTTCAGTT
TTCTACACTAATGTTGGGCCCATGCTCAACCCTCTGATCTACAGTTTGAGGAACAAAGAT
GTCAAGGTGGCGTTAAGGAAATCATTTATTAAGTTTCAGAGAGAATATAAATTT


Conceptual translation

MLKFWNRAGSSINKSFFSPRFSKVSMLAGNGSFVTEFVLAGLTDCPELQLPLFFLFLIIY
IITVAGNIGLIILIGLNPHLHTPMYYFLFNLSFIDLSYSSVFSPKMLMNFVSEKNSISFE
GCMTQLFLFLFFVISECYMLTSMAYDRYVAICNPLLYKVTMSPQVCSILSFAAYGMGFAG
ASVHTGCMLRLTFCNANLINHYLCDILPLLQLSCTSTYVNEVVVLVVVGINITVPSCTIL
ISYVFILANILNIKSTQGRSKAFSTCSSHIMAISLFFGSAAFMYLRYSSGSMEQGKISSV
FYTNVGPMLNPLIYSLRNKDVKVALRKSFIKFQREYKF