Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8b3e-ps Olfactory Receptor

Gene Symbol Or8b3e-ps
Organism Rat
Family 8
Subfamily b
Pseudo Yes
Location chr4:1709706-1710584 (-)
Aliases Olr1255-ps, Olr1255-ps

Sequence information


Nucleotide sequence

GATTGTCCAGAGCTCCAGCTGCCTCTCTTTTTCTTGTTTCTAATAATCTACATAATCACA
GTGGTGGGAAACATTGGACTGATTATTCTGATTGGCCTCAATCCTCATCTGCACACTCCA
ATGTACTACTTCCTCTTCAACCTCTCCTTCATTGATCTCAGCTACTCTTCTGCTTTCAGT
CCCAAAATGCTGAACTTTGTCTCTGAGAAGAACTCCATCTCCTATGAGGGTTGCATGACT
CAACTGTTTTTCTTTCTCTTTTTTGTCATCACTGAATGCTACATGTTGACCTCAATGGCC
TATGATCGGTATGTGGCCATCTGTAATCCTCTCCTGTATAAGGTCACCATGTCTCCTCAA
GTCTGTTTTATGCTATCTTTTGCTTCTTATGGGATGGCATTCGCTGGAGCCTCTGCCCAC
ACAGGCTGCATGCTCAGACTAACTTTCTGCAATGCCAAGGTCATCAACTTTTATTTGTGT
GATATTCTGCCTCTCCTCCAACTTTCCTGCACCAGTACATATGTCAATGAGGTCATCGTT
CTCATAGTTGGGGGTATTAACATCACAGTCCCCAGCTGTACGATCCTCATTTCCTATGTT
TTCATCCTTGGCAGCATTCTAAACATCAAATCCAGACAAGGAAGGTCAAAAGCCTTCAAT
ACCTGTAGCTCCCACATTATGGCAATTTCTATGTTTTTTGGGTCAGGGACATTCATGTAC
TTTAATCATTCTGGATCTATGGACCAAGGAAAAATTTCTTCTGTTTTTTACACTAATGTG
GTTCCAATGCTCAACCCTCTAATCTACAGTTTGAGGAACAAGGATGTCAAAGTAGCACTG
AAGAAAGTTATGATTAAAGTCCACAGCAGATTCATAACC


Conceptual translation

MLAGNGSFVTEFVLAGL/DCPELQLPLFFLFLIIYIITVVGNIGLIILIGLNPHLHTPM
YYFLFNLSFIDLSYSSAFSPKMLNFVSEKNSISYEGCMTQLFFFLFFVITECYMLTSMAY
DRYVAICNPLLYKVTMSPQVCFMLSFASYGMAFAGASAHTGCMLRLTFCNAKVINFYLCD
ILPLLQLSCTSTYVNEVIVLIVGGINITVPSCTILISYVFILGSILNIKSRQGRSKAFNT
CSSHIMAISMFFGSGTFMYFNHSGSMDQGKISSVFYTNVVPMLNPLIYSLRNKDVKVALK
KVMIKVHSRFIT